9Q1Z: Measles virus Hemagglutinin ectodomain

Structure of the Measles virus Hemagglutinin ectodomain in complex with neutralizing antibody 1C02. Determined by electron microscopy at 3.05 Å resolution. Released 1 Jul 2026.

Method: Electron microscopy
Resolution: 3.05 Å
Organisms: Homo sapiens, Measles morbillivirus
Chains: 6
Atoms: 9,799
Mol. weight: 244.65 kDa
Ligands: NAG
Released: 1 Jul 2026

Explore 9Q1Z in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9Q1Z contains 28 α-helices and 129 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	5-6	2	1
β-strand	10-12	3	2
β-strand	18-23	6	1
α-helix	28-31	4
β-strand	32-39	8	2
β-strand	45-52	8	2
β-strand	57-60	4	2
β-strand	68-73	6	1
β-strand	78-83	6	1
β-strand	92-100	9	2
β-strand	101	1	3
β-strand	106	1	3
α-helix	108-110	3
β-strand	115	1	2
α-helix	116-118	3
β-strand	119-123	5	2

Chain B: 1 helix, 15 β-strands

Element	Residues	Length	Sheet
β-strand	25	1	4
β-strand	26	1	5
β-strand	30-33	4	6
β-strand	39-44	6	5
β-strand	57-61	5	6
β-strand	68-71	4	6
β-strand	72	1	7
β-strand	76	1	7
β-strand	85-90	6	5
β-strand	93-98	6	5
β-strand	108-112	5	6
β-strand	113-115	3	8
β-strand	120-122	3	8
β-strand	124	1	4
β-strand	127-131	5	6
α-helix	132	1

Chain C: 4 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	7-9	3
β-strand	10-12	3	9
β-strand	18-21	4	10
α-helix	28-30	3
β-strand	33-39	7	9
β-strand	45-52	8	9
β-strand	57-60	4	9
β-strand	68-73	6	10
β-strand	78-83	6	10
α-helix	88-90	3
β-strand	92-99	8	9
β-strand	101	1	11
β-strand	106	1	11
α-helix	108-110	3
β-strand	112-115	4	9
β-strand	119-123	5	9

Chain D: 10 helices, 36 β-strands

Element	Residues	Length	Sheet
β-strand	192-194	3	12
β-strand	203	1	13
α-helix	205-211	7
β-strand	215-224	10	13
β-strand	227-236	10	13
β-strand	250-261	12	13
β-strand	269-279	11	13
β-strand	286-291	6	14
β-strand	295-301	7	14
β-strand	305-307	3	14
β-strand	318	1	15
β-strand	320-325	6	14
β-strand	333-335	3	14
β-strand	338	1	15
β-strand	339-340	2	14
β-strand	346-350	5	14
β-strand	353-358	6	14
β-strand	363-371	9	14
α-helix	372-375	4
α-helix	379-385	7
α-helix	388-390	3
α-helix	391-394	4
α-helix	400-403	4
β-strand	408-415	8	14
β-strand	425-430	6	14
α-helix	434-435	2
β-strand	440-445	6	14
β-strand	452-456	5	14
β-strand	463	1	16
β-strand	466-471	6	14
β-strand	477-482	6	14
β-strand	484-486	3	17
β-strand	495-497	3	17
β-strand	499	1	16
α-helix	500-501	2
β-strand	508-511	4	18
β-strand	515-516	2	18
α-helix	517-518	2
β-strand	524-525	2	18
β-strand	528-530	3	18
β-strand	537-544	8	18
α-helix	545-547	3
β-strand	549-556	8	18
β-strand	562-572	11	12
β-strand	577-586	10	12
β-strand	594-602	9	12

Chain E: 1 helix, 15 β-strands

Element	Residues	Length	Sheet
β-strand	25	1	19
β-strand	26	1	20
β-strand	30-33	4	21
β-strand	39-44	6	20
β-strand	57-61	5	21
β-strand	68-71	4	21
β-strand	72	1	22
β-strand	76	1	22
β-strand	85-89	5	20
β-strand	93-98	6	20
β-strand	108-112	5	21
β-strand	113-115	3	23
β-strand	120-122	3	23
β-strand	124	1	19
β-strand	127-131	5	21
α-helix	132	1

Chain F: 9 helices, 38 β-strands

Element	Residues	Length	Sheet
α-helix	190-191	2
β-strand	192-193	2	24
β-strand	203	1	25
α-helix	205-211	7
β-strand	215-224	10	25
β-strand	227-236	10	25
β-strand	250-261	12	25
β-strand	269-279	11	25
β-strand	287-292	6	26
β-strand	295-300	6	26
β-strand	305-307	3	26
β-strand	318	1	27
β-strand	320-325	6	26
β-strand	333-335	3	26
β-strand	338	1	27
β-strand	339-341	3	26
β-strand	346-350	5	26
β-strand	354-359	6	26
β-strand	362-371	10	26
α-helix	372-375	4
α-helix	380-386	7
α-helix	391-394	4
β-strand	408-416	9	26
β-strand	425-430	6	26
α-helix	434-435	2
β-strand	441-445	5	26
β-strand	451-456	6	26
β-strand	459	1	28
β-strand	463	1	28
β-strand	466-471	6	26
β-strand	477-482	6	26
β-strand	484-486	3	29
α-helix	488-490	3
β-strand	495-497	3	29
β-strand	499	1	28
β-strand	508-511	4	30
β-strand	515-516	2	30
α-helix	517-518	2
β-strand	524-530	7	30
β-strand	537-544	8	30
α-helix	545-547	3
β-strand	549-550	2	30
β-strand	553	1	30
β-strand	556	1	30
β-strand	562-572	11	24
β-strand	577-586	10	24
β-strand	594-602	9	24

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
1C02 Fab Heavy chain	A, C	protein	253	Homo sapiens
1C02 Fab Light chain	B, E	protein	238	Homo sapiens
Hemagglutinin glycoprotein	D, F	protein	617	Measles morbillivirus	Q786F2 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>9Q1Z_1 1C02 Fab Heavy chain (chains A, C)
METDTLLLWVLLLWVPGSTGDEVQLLESGAEVKKPGSSVKVSCKASGGTFSSYGISWVRQ
APGQGLEWMGGIIPIFGTANYAQKFRGRVTITADKSTSTAYMELSSLRSEDTAVYYCARE
RITVAGINYYYGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP
EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKV
DKRVEPKSCDKTH

Sequence of entity 2 (B, E), FASTA

>9Q1Z_2 1C02 Fab Light chain (chains B, E)
METDTLLLWVLLLWVPGSTGDRPVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQ
QLPGTAPKLLIYGDSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSG
VVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSP
VKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Sequence of entity 3 (D, F), FASTA

>9Q1Z_3 Hemagglutinin glycoprotein (chains D, F)
MSPQRDRINAFYKDNPHPKGSRIVINREHLMIDRPYVLLAVLFVMFLSLIGLLAIAGIRL
HRAAIYTAEIHKSLSTNLDVTNSIEHQVKDVLTPLFKIIGDEVGLRTPQRFTDLVKFISD
KIKFLNPDREYDFRDLTWCINPPERIKLDYDQYCADVAAEELMNALVNSTLLEARATNQF
LAVSKGNCSGPTTIRGQFSNMSLSLLDLYLSRGYNVSSIVTMTSQGMYGGTYLVGKPNLS
SKGSELSQLSMHRVFEVGVIRNPGLGAPVFHMTNYFEQPVSNDFSNCMVALGELKFAALC
HREDSITIPYQGSGKGVSFQLVKLGVWKSPTDMRSWVPLSTDDPVIDRLYLSSHRGVIAD
NQAKWAVPTTRTDDKLRMETCFQQACKGKNQALCENPEWAPLKDNRIPSYGVLSVNLSLT
VELKIKIASGFGPLITHGSGMDLYKTNHNNVYWLTIPPMKNLALGVINTLEWIPRFKVSP
NLFTVPIKEAGEDCHAPTYLPAEVDGDVKLSSNLVILPGQDLQYVLATYDTSRVEHAVVY
YVYSPSRSFSYFYPFRLPIKGVPIELQVECFTWDKKLWCRHFCVLADSESGGHITHSGMV
GMGVSCTVTREDGTNRR

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Primary citation

Human neutralizing antibodies targeting the measles virus hemagglutinin and fusion surface proteins. Acciani, M., Zyla, D., Niemeyer, G. et al. Cell Host Microbe (2026) 34:1067-1081.e12. DOI 10.1016/j.chom.2026.04.010 · PubMed

Other PDB entries of the same protein (UniProt Q786F2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4GJT 3.1 Å, complex structure of nectin-4 bound to MV-H
9Q20 3.25 Å, Structure of the Measles virus Hemagglutinin ectodomain in complex with neutralizing…
9Q24 3.25 Å, Structure of the Measles virus Hemagglutinin ectodomain in complex with two neutralizing…

Browse structure collections

About this viewer

MolViewer shows 9Q1Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.