9Q24: Measles virus Hemagglutinin ectodomain

Structure of the Measles virus Hemagglutinin ectodomain in complex with two neutralizing antibodies 1C08 and 4D08. Determined by electron microscopy at 3.25 Å resolution. Released 1 Jul 2026.

Method: Electron microscopy
Resolution: 3.25 Å
Organisms: Homo sapiens, Measles morbillivirus
Chains: 10
Atoms: 13,554
Mol. weight: 354.1 kDa
Ligands: NAG
Released: 1 Jul 2026

Explore 9Q24 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9Q24 contains 23 α-helices and 164 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 37 β-strands

Element	Residues	Length	Sheet
β-strand	192-193	2	4
β-strand	195-196	2	24
β-strand	199	1	24
β-strand	203	1	25
α-helix	205-211	7
β-strand	217-224	8	25
β-strand	227-234	8	25
β-strand	252-261	10	25
β-strand	269-278	10	25
β-strand	288-292	5	26
β-strand	295-300	6	26
β-strand	305-307	3	26
α-helix	308-309	2
β-strand	310	1	27
β-strand	317-323	7	26
β-strand	333-339	7	26
β-strand	341	1	27
β-strand	346-350	5	26
β-strand	354-359	6	26
β-strand	362-371	10	26
α-helix	374-377	4
α-helix	379-385	7
α-helix	391-394	4
α-helix	402-404	3
β-strand	408-416	9	26
β-strand	425-430	6	26
β-strand	441-445	5	26
β-strand	452-456	5	26
β-strand	459	1	28
β-strand	463	1	28
β-strand	466-471	6	26
β-strand	477-482	6	26
β-strand	484-486	3	29
β-strand	495-497	3	29
β-strand	511	1	30
β-strand	515-517	3	30
β-strand	523-530	8	30
β-strand	537-543	7	30
β-strand	551-556	6	30
β-strand	562-572	11	24
β-strand	577-586	10	24
β-strand	593-603	11	24
β-strand	606	1	4

Chain B: 2 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	1
α-helix	7-9	3
β-strand	10-12	3	2
β-strand	20-25	6	1
β-strand	33-38	6	3
β-strand	46-52	7	3
β-strand	58-60	3	3
β-strand	70-72	3	1
β-strand	78-81	4	1
α-helix	88-90	3
β-strand	92	1	2
β-strand	95-99	5	3
β-strand	107-108	2	4
β-strand	119	1	3
β-strand	125	1	3
β-strand	128-130	3	2

Chain C: 1 helix, 9 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	5
β-strand	10-13	4	6
β-strand	19-25	7	5
β-strand	33-38	6	6
β-strand	45-48	4	6
β-strand	62-67	6	5
β-strand	70-75	6	5
α-helix	80-82	3
β-strand	85-90	6	6
β-strand	102-106	5	6

Chain D: 3 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	7
β-strand	16-24	9	7
α-helix	28-30	3
β-strand	33-38	6	8
β-strand	44-50	7	8
β-strand	59-61	3	8
α-helix	63-65	3
β-strand	69-74	6	7
β-strand	79-85	7	7
α-helix	89-91	3
β-strand	94-98	5	8
β-strand	114-115	2	8

Chain E: 0 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	2-4	3	9
β-strand	7-9	3	10
β-strand	16-21	6	9
β-strand	27	1	11
β-strand	33	1	11
β-strand	36-40	5	10
β-strand	50-51	2	10
β-strand	55-56	2	10
β-strand	64-69	6	9
β-strand	72-77	6	9
β-strand	87-91	5	10
β-strand	103-107	5	10

Chain F: 8 helices, 36 β-strands

Element	Residues	Length	Sheet
β-strand	195-199	5	31
β-strand	203	1	32
α-helix	205-211	7
β-strand	215-223	9	32
β-strand	228-235	8	32
β-strand	252-261	10	32
β-strand	269-279	11	32
β-strand	288-292	5	33
β-strand	295-300	6	33
β-strand	305-307	3	34
α-helix	308-309	2
β-strand	310	1	35
β-strand	317-323	7	33
β-strand	333-339	7	33
β-strand	341	1	35
β-strand	346	1	36
β-strand	348-350	3	34
β-strand	353-359	7	33
β-strand	362-370	9	33
β-strand	371	1	36
α-helix	374-377	4
α-helix	379-383	5
α-helix	391-395	5
α-helix	400-403	4
β-strand	408-416	9	33
β-strand	425-430	6	33
α-helix	434-435	2
β-strand	440-445	6	33
β-strand	451-456	6	33
β-strand	459	1	37
β-strand	463	1	37
β-strand	466-471	6	33
β-strand	477-482	6	33
β-strand	484-486	3	38
α-helix	488-490	3
β-strand	495-497	3	38
β-strand	510-511	2	39
β-strand	515-517	3	39
β-strand	523-530	8	39
β-strand	537-543	7	39
β-strand	552-556	5	39
β-strand	563-573	11	31
β-strand	576-585	10	31
β-strand	594-603	10	31

Chain G: 0 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	12
β-strand	11-12	2	13
β-strand	17-25	9	12
β-strand	33-37	5	14
β-strand	49-52	4	14
β-strand	58-60	3	14
β-strand	68-73	6	12
β-strand	78-84	7	12
β-strand	95-99	5	14
β-strand	119-122	4	14
β-strand	129-130	2	13

Chain H: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	15
β-strand	10-11	2	16
β-strand	19	1	15
β-strand	22-24	3	15
β-strand	33-38	6	16
β-strand	45-48	4	16
β-strand	54	1	16
β-strand	62-67	6	15
β-strand	70-75	6	15
α-helix	80-82	3
β-strand	85-90	6	16
β-strand	102-104	3	16

2 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
4D08 Fab heavy chain	B, G	protein	260	Homo sapiens
4D08 Fab Light Chain	C, H	protein	235	Homo sapiens
1C08 Fab Heavy chain	D, I	protein	249	Homo sapiens
1C08 Fab Light chain	E, J	protein	240	Homo sapiens
Hemagglutinin glycoprotein	A, F	protein	617	Measles morbillivirus	Q786F2 (AlphaFold model)

Sequence of entity 1 (B, G), FASTA

>9Q24_1 4D08 Fab heavy chain (chains B, G)
METDTLLLWVLLLWVPGSTGDQMQLVQSGAEVKKPGASVKVSCKASGYTFTSYAMHWVRQ
APGQRLEWMGWINAGNGKTEYSQRFQGRVTITRDTSASTVYMELNSLRSEDTAVYFCARD
AYDFWSGYGNWGSNYYYFYMDAWGKGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGC
LVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNH
KPSNTKVDKRVEPKSCDKTH

Sequence of entity 2 (C, H), FASTA

>9Q24_2 4D08 Fab Light Chain (chains C, H)
METDTLLLWVLLLWVPGSTGDEIVMTQSPPSLSASVGDRVTITCRASQSINYYLNWYQQK
PGKAPKLLIYAASGLQSGVPSRFSGSGSGTDFTLTISSLQPEDLATYYCQQTYSTPVTFG
QGTKLEIIRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNS
QESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 3 (D, I), FASTA

>9Q24_3 1C08 Fab Heavy chain (chains D, I)
METDTLLLWVLLLWVPGSTGDEVQLLESGGSLVKPGGSLRLSCSASGFTFNRAWMNWVRQ
APGKGLEWVGHIRNEVDGGTTEYAAPVKGRFTISRDDSKNTLYLQMNSLKAEDSATYYCT
TDLFRFGFGDVWGQGTTVIVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVT
VSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRV
EPKSCDKTH

Sequence of entity 4 (E, J), FASTA

>9Q24_4 1C08 Fab Light chain (chains E, J)
METDTLLLWVLLLWVPGSTGDEIVMTQSPLSLSVTPGEPASISCRSSQSLLHSNGYNYLD
WYVQKPGQSPQVLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQPLQT
PRTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNAL
QSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 5 (A, F), FASTA

>9Q24_5 Hemagglutinin glycoprotein (chains A, F)
MSPQRDRINAFYKDNPHPKGSRIVINREHLMIDRPYVLLAVLFVMFLSLIGLLAIAGIRL
HRAAIYTAEIHKSLSTNLDVTNSIEHQVKDVLTPLFKIIGDEVGLRTPQRFTDLVKFISD
KIKFLNPDREYDFRDLTWCINPPERIKLDYDQYCADVAAEELMNALVNSTLLEARATNQF
LAVSKGNCSGPTTIRGQFSNMSLSLLDLYLSRGYNVSSIVTMTSQGMYGGTYLVGKPNLS
SKGSELSQLSMHRVFEVGVIRNPGLGAPVFHMTNYFEQPVSNDFSNCMVALGELKFAALC
HREDSITIPYQGSGKGVSFQLVKLGVWKSPTDMRSWVPLSTDDPVIDRLYLSSHRGVIAD
NQAKWAVPTTRTDDKLRMETCFQQACKGKNQALCENPEWAPLKDNRIPSYGVLSVNLSLT
VELKIKIASGFGPLITHGSGMDLYKTNHNNVYWLTIPPMKNLALGVINTLEWIPRFKVSP
NLFTVPIKEAGEDCHAPTYLPAEVDGDVKLSSNLVILPGQDLQYVLATYDTSRVEHAVVY
YVYSPSRSFSYFYPFRLPIKGVPIELQVECFTWDKKLWCRHFCVLADSESGGHITHSGMV
GMGVSCTVTREDGTNRR

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	5

Primary citation

Human neutralizing antibodies targeting the measles virus hemagglutinin and fusion surface proteins. Acciani, M., Zyla, D., Niemeyer, G. et al. Cell Host Microbe (2026) 34:1067-1081.e12. DOI 10.1016/j.chom.2026.04.010 · PubMed

Other PDB entries of the same protein (UniProt Q786F2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9Q1Z 3.05 Å, Structure of the Measles virus Hemagglutinin ectodomain in complex with neutralizing…
4GJT 3.1 Å, complex structure of nectin-4 bound to MV-H
9Q20 3.25 Å, Structure of the Measles virus Hemagglutinin ectodomain in complex with neutralizing…

Browse structure collections

About this viewer

MolViewer shows 9Q24 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.