9Q20: Measles virus Hemagglutinin ectodomain

Structure of the Measles virus Hemagglutinin ectodomain in complex with neutralizing antibody 1C08. Determined by electron microscopy at 3.25 Å resolution. Released 1 Jul 2026.

Method: Electron microscopy
Resolution: 3.25 Å
Organisms: Homo sapiens, Measles morbillivirus
Chains: 6
Atoms: 9,417
Mol. weight: 245.57 kDa
Ligands: NAG
Released: 1 Jul 2026

Explore 9Q20 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9Q20 contains 24 α-helices and 115 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	1
β-strand	17-25	9	1
α-helix	29-31	3
β-strand	34-38	5	2
β-strand	46-51	6	2
β-strand	60-62	3	2
α-helix	64-66	3
β-strand	70-75	6	1
β-strand	80-86	7	1
α-helix	90-92	3
β-strand	94-96	3	3
β-strand	97-100	4	2
β-strand	110-111	2	2
β-strand	115-117	3	3

Chain B: 1 helix, 13 β-strands

Element	Residues	Length	Sheet
β-strand	26	1	4
β-strand	31-34	4	5
β-strand	40-45	6	4
β-strand	51	1	6
β-strand	57	1	6
β-strand	60-64	5	5
β-strand	71-75	5	5
β-strand	79-80	2	5
α-helix	81	1
β-strand	88-93	6	4
β-strand	96-101	6	4
β-strand	110-115	6	5
β-strand	124	1	5
β-strand	128-132	5	5

Chain C: 9 helices, 34 β-strands

Element	Residues	Length	Sheet
β-strand	195	1	13
β-strand	198-199	2	14
β-strand	203	1	15
α-helix	205-211	7
β-strand	216-224	9	15
β-strand	227-234	8	15
β-strand	252-261	10	15
α-helix	268	1
β-strand	269-279	11	15
β-strand	286-292	7	16
β-strand	295-301	7	16
β-strand	305-307	3	16
α-helix	308-309	2
β-strand	310	1	17
β-strand	317-325	9	16
β-strand	333-339	7	16
β-strand	341	1	17
β-strand	346-350	5	16
β-strand	354-359	6	16
β-strand	362-371	10	16
α-helix	374-377	4
α-helix	379-384	6
α-helix	391-394	4
α-helix	400-403	4
β-strand	408-416	9	16
β-strand	425-430	6	16
α-helix	434-435	2
β-strand	441-445	5	16
β-strand	451-456	6	16
β-strand	466-471	6	16
β-strand	477-482	6	16
β-strand	484-486	3	18
α-helix	488-490	3
β-strand	495-497	3	18
β-strand	511	1	19
β-strand	515-517	3	19
β-strand	523-529	7	19
β-strand	538-543	6	19
β-strand	549-550	2	19
β-strand	563-573	11	14
β-strand	576-585	10	14
β-strand	594-602	9	14
β-strand	603	1	13

Chain D: 2 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	7
β-strand	11	1	8
β-strand	18-25	8	7
β-strand	34-39	6	9
β-strand	45-51	7	9
β-strand	60-62	3	9
α-helix	64-66	3
β-strand	70-75	6	7
β-strand	80-85	6	7
α-helix	90-92	3
β-strand	94-96	3	10
β-strand	97-100	4	9
β-strand	110-111	2	9
β-strand	115-117	3	10
β-strand	118	1	8

Chain E: 1 helix, 10 β-strands

Element	Residues	Length	Sheet
β-strand	26-27	2	11
β-strand	31-34	4	12
β-strand	40-45	6	11
β-strand	61-64	4	12
β-strand	71-75	5	12
β-strand	79-80	2	12
α-helix	81	1
β-strand	89-93	5	11
β-strand	96-101	6	11
β-strand	110-113	4	12
β-strand	128-132	5	12

Chain F: 8 helices, 34 β-strands

Element	Residues	Length	Sheet
β-strand	194-199	6	20
β-strand	203	1	21
α-helix	205-211	7
β-strand	215-223	9	21
β-strand	228-235	8	21
β-strand	252-261	10	21
β-strand	269-279	11	21
β-strand	286-292	7	22
β-strand	295-301	7	22
β-strand	305-307	3	22
α-helix	308-309	2
β-strand	310	1	23
β-strand	317-325	9	22
β-strand	333-339	7	22
β-strand	341	1	23
β-strand	346-350	5	22
β-strand	355-359	5	22
β-strand	362-371	10	22
α-helix	374-377	4
α-helix	379-387	9
α-helix	391-395	5
α-helix	400-403	4
β-strand	408-416	9	22
β-strand	425-430	6	22
α-helix	434-435	2
β-strand	442-445	4	22
β-strand	451-456	6	22
β-strand	459	1	24
β-strand	462	1	24
β-strand	466-471	6	22
β-strand	477-482	6	22
β-strand	484-486	3	25
β-strand	495-497	3	25
β-strand	509-511	3	26
β-strand	515-517	3	26
α-helix	518	1
β-strand	523-530	8	26
β-strand	539-543	5	26
β-strand	549-551	3	26
β-strand	563-572	10	20
β-strand	577-585	9	20
β-strand	595-604	10	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
1C08 Fab Heavy chain	A, D	protein	249	Homo sapiens
1C08 Fab Light chain	B, E	protein	240	Homo sapiens
Hemagglutinin glycoprotein	C, F	protein	617	Measles morbillivirus	Q786F2 (AlphaFold model)

Sequence of entity 1 (A, D), FASTA

>9Q20_1 1C08 Fab Heavy chain (chains A, D)
METDTLLLWVLLLWVPGSTGDEVQLLESGGSLVKPGGSLRLSCSASGFTFNRAWMNWVRQ
APGKGLEWVGHIRNEVDGGTTEYAAPVKGRFTISRDDSKNTLYLQMNSLKAEDSATYYCT
TDLFRFGFGDVWGQGTTVIVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVT
VSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRV
EPKSCDKTH

Sequence of entity 2 (B, E), FASTA

>9Q20_2 1C08 Fab Light chain (chains B, E)
METDTLLLWVLLLWVPGSTGDEIVMTQSPLSLSVTPGEPASISCRSSQSLLHSNGYNYLD
WYVQKPGQSPQVLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQPLQT
PRTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNAL
QSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 3 (C, F), FASTA

>9Q20_3 Hemagglutinin glycoprotein (chains C, F)
MSPQRDRINAFYKDNPHPKGSRIVINREHLMIDRPYVLLAVLFVMFLSLIGLLAIAGIRL
HRAAIYTAEIHKSLSTNLDVTNSIEHQVKDVLTPLFKIIGDEVGLRTPQRFTDLVKFISD
KIKFLNPDREYDFRDLTWCINPPERIKLDYDQYCADVAAEELMNALVNSTLLEARATNQF
LAVSKGNCSGPTTIRGQFSNMSLSLLDLYLSRGYNVSSIVTMTSQGMYGGTYLVGKPNLS
SKGSELSQLSMHRVFEVGVIRNPGLGAPVFHMTNYFEQPVSNDFSNCMVALGELKFAALC
HREDSITIPYQGSGKGVSFQLVKLGVWKSPTDMRSWVPLSTDDPVIDRLYLSSHRGVIAD
NQAKWAVPTTRTDDKLRMETCFQQACKGKNQALCENPEWAPLKDNRIPSYGVLSVNLSLT
VELKIKIASGFGPLITHGSGMDLYKTNHNNVYWLTIPPMKNLALGVINTLEWIPRFKVSP
NLFTVPIKEAGEDCHAPTYLPAEVDGDVKLSSNLVILPGQDLQYVLATYDTSRVEHAVVY
YVYSPSRSFSYFYPFRLPIKGVPIELQVECFTWDKKLWCRHFCVLADSESGGHITHSGMV
GMGVSCTVTREDGTNRR

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	3

Primary citation

Human neutralizing antibodies targeting the measles virus hemagglutinin and fusion surface proteins. Acciani, M., Zyla, D., Niemeyer, G. et al. Cell Host Microbe (2026) 34:1067-1081.e12. DOI 10.1016/j.chom.2026.04.010 · PubMed

Other PDB entries of the same protein (UniProt Q786F2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9Q1Z 3.05 Å, Structure of the Measles virus Hemagglutinin ectodomain in complex with neutralizing…
4GJT 3.1 Å, complex structure of nectin-4 bound to MV-H
9Q24 3.25 Å, Structure of the Measles virus Hemagglutinin ectodomain in complex with two neutralizing…

Browse structure collections

About this viewer

MolViewer shows 9Q20 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.