9Q20: Measles virus Hemagglutinin ectodomain
Structure of the Measles virus Hemagglutinin ectodomain in complex with neutralizing antibody 1C08. Determined by electron microscopy at 3.25 Å resolution. Released 1 Jul 2026.
- Method
- Electron microscopy
- Resolution
- 3.25 Å
- Organisms
- Homo sapiens, Measles morbillivirus
- Chains
- 6
- Atoms
- 9,417
- Mol. weight
- 245.57 kDa
- Ligands
- NAG
- Released
- 1 Jul 2026
Explore 9Q20 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
9Q20 contains 24 α-helices and 115 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 3 helices, 11 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3-7 | 5 | 1 |
| β-strand | 17-25 | 9 | 1 |
| α-helix | 29-31 | 3 | |
| β-strand | 34-38 | 5 | 2 |
| β-strand | 46-51 | 6 | 2 |
| β-strand | 60-62 | 3 | 2 |
| α-helix | 64-66 | 3 | |
| β-strand | 70-75 | 6 | 1 |
| β-strand | 80-86 | 7 | 1 |
| α-helix | 90-92 | 3 | |
| β-strand | 94-96 | 3 | 3 |
| β-strand | 97-100 | 4 | 2 |
| β-strand | 110-111 | 2 | 2 |
| β-strand | 115-117 | 3 | 3 |
Chain B: 1 helix, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 26 | 1 | 4 |
| β-strand | 31-34 | 4 | 5 |
| β-strand | 40-45 | 6 | 4 |
| β-strand | 51 | 1 | 6 |
| β-strand | 57 | 1 | 6 |
| β-strand | 60-64 | 5 | 5 |
| β-strand | 71-75 | 5 | 5 |
| β-strand | 79-80 | 2 | 5 |
| α-helix | 81 | 1 | |
| β-strand | 88-93 | 6 | 4 |
| β-strand | 96-101 | 6 | 4 |
| β-strand | 110-115 | 6 | 5 |
| β-strand | 124 | 1 | 5 |
| β-strand | 128-132 | 5 | 5 |
Chain C: 9 helices, 34 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 195 | 1 | 13 |
| β-strand | 198-199 | 2 | 14 |
| β-strand | 203 | 1 | 15 |
| α-helix | 205-211 | 7 | |
| β-strand | 216-224 | 9 | 15 |
| β-strand | 227-234 | 8 | 15 |
| β-strand | 252-261 | 10 | 15 |
| α-helix | 268 | 1 | |
| β-strand | 269-279 | 11 | 15 |
| β-strand | 286-292 | 7 | 16 |
| β-strand | 295-301 | 7 | 16 |
| β-strand | 305-307 | 3 | 16 |
| α-helix | 308-309 | 2 | |
| β-strand | 310 | 1 | 17 |
| β-strand | 317-325 | 9 | 16 |
| β-strand | 333-339 | 7 | 16 |
| β-strand | 341 | 1 | 17 |
| β-strand | 346-350 | 5 | 16 |
| β-strand | 354-359 | 6 | 16 |
| β-strand | 362-371 | 10 | 16 |
| α-helix | 374-377 | 4 | |
| α-helix | 379-384 | 6 | |
| α-helix | 391-394 | 4 | |
| α-helix | 400-403 | 4 | |
| β-strand | 408-416 | 9 | 16 |
| β-strand | 425-430 | 6 | 16 |
| α-helix | 434-435 | 2 | |
| β-strand | 441-445 | 5 | 16 |
| β-strand | 451-456 | 6 | 16 |
| β-strand | 466-471 | 6 | 16 |
| β-strand | 477-482 | 6 | 16 |
| β-strand | 484-486 | 3 | 18 |
| α-helix | 488-490 | 3 | |
| β-strand | 495-497 | 3 | 18 |
| β-strand | 511 | 1 | 19 |
| β-strand | 515-517 | 3 | 19 |
| β-strand | 523-529 | 7 | 19 |
| β-strand | 538-543 | 6 | 19 |
| β-strand | 549-550 | 2 | 19 |
| β-strand | 563-573 | 11 | 14 |
| β-strand | 576-585 | 10 | 14 |
| β-strand | 594-602 | 9 | 14 |
| β-strand | 603 | 1 | 13 |
Chain D: 2 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3-7 | 5 | 7 |
| β-strand | 11 | 1 | 8 |
| β-strand | 18-25 | 8 | 7 |
| β-strand | 34-39 | 6 | 9 |
| β-strand | 45-51 | 7 | 9 |
| β-strand | 60-62 | 3 | 9 |
| α-helix | 64-66 | 3 | |
| β-strand | 70-75 | 6 | 7 |
| β-strand | 80-85 | 6 | 7 |
| α-helix | 90-92 | 3 | |
| β-strand | 94-96 | 3 | 10 |
| β-strand | 97-100 | 4 | 9 |
| β-strand | 110-111 | 2 | 9 |
| β-strand | 115-117 | 3 | 10 |
| β-strand | 118 | 1 | 8 |
Chain E: 1 helix, 10 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 26-27 | 2 | 11 |
| β-strand | 31-34 | 4 | 12 |
| β-strand | 40-45 | 6 | 11 |
| β-strand | 61-64 | 4 | 12 |
| β-strand | 71-75 | 5 | 12 |
| β-strand | 79-80 | 2 | 12 |
| α-helix | 81 | 1 | |
| β-strand | 89-93 | 5 | 11 |
| β-strand | 96-101 | 6 | 11 |
| β-strand | 110-113 | 4 | 12 |
| β-strand | 128-132 | 5 | 12 |
Chain F: 8 helices, 34 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 194-199 | 6 | 20 |
| β-strand | 203 | 1 | 21 |
| α-helix | 205-211 | 7 | |
| β-strand | 215-223 | 9 | 21 |
| β-strand | 228-235 | 8 | 21 |
| β-strand | 252-261 | 10 | 21 |
| β-strand | 269-279 | 11 | 21 |
| β-strand | 286-292 | 7 | 22 |
| β-strand | 295-301 | 7 | 22 |
| β-strand | 305-307 | 3 | 22 |
| α-helix | 308-309 | 2 | |
| β-strand | 310 | 1 | 23 |
| β-strand | 317-325 | 9 | 22 |
| β-strand | 333-339 | 7 | 22 |
| β-strand | 341 | 1 | 23 |
| β-strand | 346-350 | 5 | 22 |
| β-strand | 355-359 | 5 | 22 |
| β-strand | 362-371 | 10 | 22 |
| α-helix | 374-377 | 4 | |
| α-helix | 379-387 | 9 | |
| α-helix | 391-395 | 5 | |
| α-helix | 400-403 | 4 | |
| β-strand | 408-416 | 9 | 22 |
| β-strand | 425-430 | 6 | 22 |
| α-helix | 434-435 | 2 | |
| β-strand | 442-445 | 4 | 22 |
| β-strand | 451-456 | 6 | 22 |
| β-strand | 459 | 1 | 24 |
| β-strand | 462 | 1 | 24 |
| β-strand | 466-471 | 6 | 22 |
| β-strand | 477-482 | 6 | 22 |
| β-strand | 484-486 | 3 | 25 |
| β-strand | 495-497 | 3 | 25 |
| β-strand | 509-511 | 3 | 26 |
| β-strand | 515-517 | 3 | 26 |
| α-helix | 518 | 1 | |
| β-strand | 523-530 | 8 | 26 |
| β-strand | 539-543 | 5 | 26 |
| β-strand | 549-551 | 3 | 26 |
| β-strand | 563-572 | 10 | 20 |
| β-strand | 577-585 | 9 | 20 |
| β-strand | 595-604 | 10 | 20 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| 1C08 Fab Heavy chain | A, D | protein | 249 | Homo sapiens | |
| 1C08 Fab Light chain | B, E | protein | 240 | Homo sapiens | |
| Hemagglutinin glycoprotein | C, F | protein | 617 | Measles morbillivirus | Q786F2 (AlphaFold model) |
Sequence of entity 1 (A, D), FASTA
>9Q20_1 1C08 Fab Heavy chain (chains A, D)
METDTLLLWVLLLWVPGSTGDEVQLLESGGSLVKPGGSLRLSCSASGFTFNRAWMNWVRQ
APGKGLEWVGHIRNEVDGGTTEYAAPVKGRFTISRDDSKNTLYLQMNSLKAEDSATYYCT
TDLFRFGFGDVWGQGTTVIVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVT
VSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRV
EPKSCDKTH
Sequence of entity 2 (B, E), FASTA
>9Q20_2 1C08 Fab Light chain (chains B, E)
METDTLLLWVLLLWVPGSTGDEIVMTQSPLSLSVTPGEPASISCRSSQSLLHSNGYNYLD
WYVQKPGQSPQVLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQPLQT
PRTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNAL
QSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Sequence of entity 3 (C, F), FASTA
>9Q20_3 Hemagglutinin glycoprotein (chains C, F)
MSPQRDRINAFYKDNPHPKGSRIVINREHLMIDRPYVLLAVLFVMFLSLIGLLAIAGIRL
HRAAIYTAEIHKSLSTNLDVTNSIEHQVKDVLTPLFKIIGDEVGLRTPQRFTDLVKFISD
KIKFLNPDREYDFRDLTWCINPPERIKLDYDQYCADVAAEELMNALVNSTLLEARATNQF
LAVSKGNCSGPTTIRGQFSNMSLSLLDLYLSRGYNVSSIVTMTSQGMYGGTYLVGKPNLS
SKGSELSQLSMHRVFEVGVIRNPGLGAPVFHMTNYFEQPVSNDFSNCMVALGELKFAALC
HREDSITIPYQGSGKGVSFQLVKLGVWKSPTDMRSWVPLSTDDPVIDRLYLSSHRGVIAD
NQAKWAVPTTRTDDKLRMETCFQQACKGKNQALCENPEWAPLKDNRIPSYGVLSVNLSLT
VELKIKIASGFGPLITHGSGMDLYKTNHNNVYWLTIPPMKNLALGVINTLEWIPRFKVSP
NLFTVPIKEAGEDCHAPTYLPAEVDGDVKLSSNLVILPGQDLQYVLATYDTSRVEHAVVY
YVYSPSRSFSYFYPFRLPIKGVPIELQVECFTWDKKLWCRHFCVLADSESGGHITHSGMV
GMGVSCTVTREDGTNRR
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 3 |
Primary citation
Human neutralizing antibodies targeting the measles virus hemagglutinin and fusion surface proteins. Acciani, M., Zyla, D., Niemeyer, G. et al. Cell Host Microbe (2026) 34:1067-1081.e12. DOI 10.1016/j.chom.2026.04.010 · PubMed
Other PDB entries of the same protein (UniProt Q786F2 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 9Q1Z 3.05 Å, Structure of the Measles virus Hemagglutinin ectodomain in complex with neutralizing…
- 4GJT 3.1 Å, complex structure of nectin-4 bound to MV-H
- 9Q24 3.25 Å, Structure of the Measles virus Hemagglutinin ectodomain in complex with two neutralizing…
Browse structure collections
About this viewer
MolViewer shows 9Q20 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.