CryoEM Structure of human MDA5 disease-linked mutant T331I with dsRNA (one protein subunit on dsRNA). Determined by electron microscopy at 3.12 Å resolution. Released 16 Sept 2026.
Explore 9Q60 in 3D Show helices and sheets RCSB PDB PDBe
9Q60 contains 33 α-helices and 24 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 310-321 | 12 | |
| β-strand | 325-328 | 4 | 1 |
| α-helix | 335-352 | 18 | |
| β-strand | 359-363 | 5 | 1 |
| α-helix | 366-372 | 7 | |
| α-helix | 373-377 | 5 | |
| α-helix | 378-381 | 4 | |
| β-strand | 387-390 | 4 | 1 |
| α-helix | 395-397 | 3 | |
| α-helix | 400-406 | 7 | |
| β-strand | 409-413 | 5 | 1 |
| α-helix | 414-426 | 13 | |
| α-helix | 431-433 | 3 | |
| α-helix | 434-436 | 3 | |
| β-strand | 439-443 | 5 | 1 |
| α-helix | 445-447 | 3 | |
| α-helix | 453-473 | 21 | |
| β-strand | 483-488 | 6 | 1 |
| α-helix | 499-512 | 14 | |
| β-strand | 517-519 | 3 | 1 |
| α-helix | 525-531 | 7 | |
| α-helix | 533-535 | 3 | |
| β-strand | 536-542 | 7 | 2 |
| α-helix | 549-565 | 17 | |
| α-helix | 572 | 1 | |
| α-helix | 576-591 | 16 | |
| α-helix | 595-616 | 22 | |
| α-helix | 619-641 | 23 | |
| α-helix | 671-692 | 22 | |
| α-helix | 694-696 | 3 | |
| α-helix | 699-712 | 14 | |
| β-strand | 721-725 | 5 | 2 |
| α-helix | 728-740 | 13 | |
| α-helix | 742-746 | 5 | |
| β-strand | 751-754 | 4 | 2 |
| α-helix | 768-780 | 13 | |
| β-strand | 787-790 | 4 | 2 |
| β-strand | 803-807 | 5 | 2 |
| α-helix | 813-820 | 8 | |
| β-strand | 829-835 | 7 | 2 |
| α-helix | 840-862 | 23 | |
| α-helix | 866-889 | 24 | |
| α-helix | 900-902 | 3 | |
| β-strand | 903-907 | 5 | 3 |
| β-strand | 913-916 | 4 | 3 |
| β-strand | 920-923 | 4 | 4 |
| β-strand | 927-930 | 4 | 4 |
| α-helix | 933-938 | 6 | |
| β-strand | 940-941 | 2 | 4 |
| α-helix | 958 | 1 | |
| β-strand | 959-961 | 3 | 4 |
| β-strand | 967-974 | 8 | 4 |
| β-strand | 977-982 | 6 | 4 |
| α-helix | 984-986 | 3 | |
| β-strand | 987-991 | 5 | 3 |
| β-strand | 998 | 1 | 3 |
| β-strand | 1012 | 1 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Interferon-induced helicase C domain-containing protein 1 | C | protein | 728 | Homo sapiens | Q9BYX4 (AlphaFold model) |
| RNA-13mer | B | RNA | 13 | synthetic construct | |
| RNA-13mer | A | RNA | 13 | synthetic construct |
>9Q60_1 Interferon-induced helicase C domain-containing protein 1 (chains C) ARASPEPELQLRPYQMEVAQPALEGKNIIICLPIGSGKTRVAVYIAKDHLDKKKKASEPG KVIVLVNKVLLVEQLFRKEFQPFLKKWYRVIGLSGDTQLKISFPEVVKSCDIIISTAQIL ENSLLNLENGEDAGVQLSDFSLIIIDECHHTNKEAVYNNIMRHYLMQKLKNNRLKKENKP VIPLPQILGLTASPGVGGATKQAKAEEHILKLCANLDAFTIKTVKENLDQLKNQIQEPCK KFAIADATREDPFKEKLLEIMTRIQTYCQMSPMSDFGTQPYEQWAIQMEKKAAKEGNRKE RVCAEHLRKYNEALQINDTIRMIDAYTHLETFYNEEKDKKFAVIEDDSDEGGDDEYCDGD EDEDDLKKPLKLDETDRFLMTLFFENNKMLKRLAENPEYENEKLTKLRNTIMEQYTRTEE SARGIIFTKTRQSAYALSQWITENEKFAEVGVKAHHLIGAGHSSEFKPMTQNEQKEVISK FRTGKINLLIATTVAEEGLDIKECNIVIRYGLVTNEIAMVQARGRARADESTYVLVAHSG SGVIEHETVNDFREKMMYKAIHCVQNMKPEEYAHKILELQMQSIMEKKMKTKRNIAKHYK NNPSLITFLCKNCSVLACSGEDIHVIEKMHHVNMTPEFKELYIVRENKALQKKCADYQIN GEIICKCGQAWGTMMVHKGLDLPCLKIRNFVVVFKNNSTKKQYKKWVELPITFPNLDYSE CCLFSDED
>9Q60_2 RNA-13mer (chains B) CGGUUAGGGGCUA
>9Q60_3 RNA-13mer (chains A) UAGCCCCUAACCG
Unraveling the molecular basis for MDA5 T331I disease-linked mutation. Xu, L., Chung, K., Guo, R. et al. To be published.
Other PDB entries of the same protein (UniProt Q9BYX4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9Q60 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.