9QPW: GluA4, resting state, structure of TMD/LBD

GluA4, resting state, structure of TMD/LBD. Determined by electron microscopy at 3.8 Å resolution. Released 24 Sept 2025.

Method: Electron microscopy
Resolution: 3.8 Å
Organism: Rattus norvegicus
Chains: 4
Atoms: 12,030
Mol. weight: 396.03 kDa
Ligands: E2Q
Released: 24 Sept 2025

Explore 9QPW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9QPW contains 72 α-helices and 72 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 18 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	417-421	5	1
β-strand	429-430	2	2
α-helix	439-442	4
β-strand	443-444	2	2
α-helix	446-458	13
β-strand	462-466	5	1
α-helix	484-490	7
β-strand	496	1	1
β-strand	497-500	4	3
α-helix	505-508	4
β-strand	511-513	3	3
α-helix	514	1
β-strand	522-527	6	4
β-strand	543	1	5
α-helix	545-564	20
α-helix	598-607	10
α-helix	618-651	34
α-helix	658-663	6
β-strand	668-670	3	4
β-strand	672	1	6
α-helix	676-682	7
α-helix	687-698	12
β-strand	705	1	6
α-helix	708-716	9
β-strand	722-727	6	4
α-helix	728-735	8
β-strand	742-745	4	4
β-strand	755-759	5	3
α-helix	766-778	13
α-helix	780-786	7
α-helix	787-791	5
β-strand	809	1	7
α-helix	812-814	3
α-helix	815-835	21

Chains B and D: 18 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	417-421	5	8
β-strand	429-430	2	9
α-helix	439-442	4
β-strand	443-444	2	9
α-helix	446-458	13
β-strand	462-466	5	8
β-strand	476	1	10
β-strand	481	1	10
α-helix	484-490	7
β-strand	497-502	6	8
α-helix	503	1
α-helix	505-510	6
β-strand	511-513	3	8
β-strand	518	1	8
β-strand	521	1	11
β-strand	524-527	4	12
α-helix	530-535	6
α-helix	538-540	3
β-strand	543	1	13
α-helix	545-566	22
α-helix	598-606	9
α-helix	618-647	30
α-helix	658-663	6
β-strand	668-670	3	12
β-strand	672	1	14
α-helix	676-682	7
α-helix	687-697	11
β-strand	705	1	14
α-helix	708-717	10
β-strand	722-724	3	12
α-helix	730-735	6
β-strand	742-745	4	12
β-strand	751	1	11
β-strand	754-759	6	8
α-helix	765-778	14
α-helix	780-790	11
β-strand	809	1	5
α-helix	811-835	25

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Isoform 2 of Glutamate receptor 4	A, B, C, D	protein	882	Rattus norvegicus	P19493 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>9QPW_1 Isoform 2 of Glutamate receptor 4 (chains A, B, C, D)
GAFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEAPFNLVPHVDNIETANSFAVT
NAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITPSFPTEGESQFVLQLRPSLRG
ALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWHVSAICVENFNDVSYRQLLEE
LDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIANLGFKDISLERFIHGGANVT
GFQLVDFNTPMVTKLMDRWKKLDQREYPGSETPPKYTSALTYDGVLVMAETFRSLRRQKI
DISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGNVQFDHYGRRVNYTMDVFELK
STGPRKVGYWNDMDKLVLIQDMPTLGNDTAAIENRTVVVTTIMESPYVMYKKNHEMFEGN
DKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAP
LTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSV
VLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSG
RIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEF
FRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYIEQRKPC
DTMKVGGNLDSKGYGVATPKGSSLRTPVNLAVLKLSEAGVLDKLKNKWWYDKGECGPKDS
GSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRAEAKRMKLTFSEATRNKAR
LSITGSVGENGRVLTPDCPKAVHTGTAIRQSSGLAVIASDLP

Ligands and cofactors

ID	Name	Formula	Copies
E2Q	6-nitro-2,3-bis(oxidanylidene)-1,4-dihydrobenzo[f]quinoxaline-7-sulfonamide	C12 H8 N4 O6 S	4

Primary citation

GluA4 AMPA receptor gating mechanisms and modulation by auxiliary proteins. Vega-Gutierrez, C., Picanol-Parraga, J., Sanchez-Valls, I. et al. Nat Struct Mol Biol (2025) 32:2416-2428. DOI 10.1038/s41594-025-01666-7 · PubMed

Other PDB entries of the same protein (UniProt P19493 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3FAS 1.4 Å, X-ray structure of iGluR4 flip ligand-binding core (S1S2) in complex with (S)-glutamate…
3EPE 1.85 Å, Crystal Structure of the GluR4 Ligand-Binding domain in complex with glutamate
3FAT 1.9 Å, X-ray structure of iGluR4 flip ligand-binding core (S1S2) in complex with (S)-AMPA at…
3KEI 1.9 Å, Crystal Structure of the GluA4 Ligand-Binding domain L651V mutant in complex with…
3KFM 2.2 Å, Crystal Structure of the GluA4 Ligand-Binding domain L651V mutant in complex with kainate
4GPA 2.25 Å, High resolution structure of the GluA4 N-terminal domain (NTD)
3EN3 2.43 Å, Crystal Structure of the GluR4 Ligand-Binding domain in complex with kainate
5FWX 2.5 Å, Crystal structure of the AMPA receptor GluA2/A4 N-terminal domain heterodimer
9QDN 2.71 Å, GluA4 in complex with TARP-2, resting state I, structure of TMD/LBD
9RMW 2.9 Å, GluA4 in complex with TARP-2, open state, structure of TMD/LBD domains
9RN7 3.1 Å, GluA4 in complex with TARP-2, Desensitized state, structure of TMD domain
9NR6 3.26 Å, The structure of Noelin 1 with cerebellar GluA1/A4-ATD

Browse structure collections

About this viewer

MolViewer shows 9QPW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.