9RKG: Beta-2 adrenergic receptor,Endolysin

Mixed model refinement of beta-2 Adrenergic receptor with photoazolol in dark state and Light state, 10 seconds after light activation, recorded at SwissFEL. Determined by X-ray diffraction at 2.45 Å resolution. Released 22 Apr 2026.

Method: X-ray diffraction
Resolution: 2.45 Å
Organisms: Homo sapiens, Tequatrovirus T4
Chains: 1
Atoms: 7,807
Mol. weight: 57.32 kDa
Ligands: ACM, CLR, PLM, OLC
Released: 22 Apr 2026

Explore 9RKG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9RKG contains 27 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 27 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	30-60	31
α-helix	67-85	19
α-helix	87-95	9
α-helix	102-135	34
α-helix	147-171	25
α-helix	179-186	8
α-helix	197-199	3
α-helix	203-204	2
α-helix	205-209	5
α-helix	210-228	19
α-helix	1003-1010	8
β-strand	1014-1015	2	1
β-strand	1016	1	2
β-strand	1017-1019	3	1
β-strand	1025-1028	4	1
β-strand	1031-1034	4	1
α-helix	1039-1050	12
β-strand	1057	1	2
α-helix	1060-1080	21
α-helix	1085-1090	6
α-helix	1093-1105	13
α-helix	1107-1112	6
α-helix	1115-1122	8
α-helix	1126-1134	9
α-helix	1137-1141	5
α-helix	1143-1155	13
α-helix	1159-1161	3
α-helix	267-298	32
α-helix	305-317	13
α-helix	318-320	3
α-helix	322-325	4
α-helix	326-328	3
α-helix	330-338	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-2 adrenergic receptor,Endolysin	A	protein	443	Homo sapiens, Tequatrovirus T4	P00720, P07550 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9RKG_1 Beta-2 adrenergic receptor,Endolysin (chains A)
ADEVWVVGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAVV
PFGAAHILMKMWTFGNFWCEFWTSIDVLCVTASIWTLCVIAVDRYFAITSPFKYQSLLTK
NKARVIILMVWIVSGLTSFLPIQMHWYRATHQEAINCYAEETCCDFFTNQAYAIASSIVS
FYVPLVIMVFVYSRVFQEAKRQLNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPS
LNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAA
LINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTW
DAYKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQDNLIRKEVYILLNWIGYVNS
GFNPLIYCRSPDFRIAFQELLCL

Ligands and cofactors

ID	Name	Formula	Copies
ACM	Acetamide	C2 H5 N O	1
CLR	Cholesterol	C27 H46 O	3
PLM	Palmitic acid	C16 H32 O2	1
OLC	(2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate	C21 H40 O4	5
A1JHU	~{N}-[4-[(~{E})-[2-[(2~{S})-2-oxidanyl-3-(propan-2-ylamino)propoxy]phenyl]diaze…	C20 H26 N4 O3	1

Water and common crystallization additives (SO4, 12P, 1PE, EDO, GOL) are not listed.

Primary citation

Structural Mechanism of an Efficacy Photoswitch Targeting the beta 2 -adrenergic Receptor. Stipp, R., Bertrand, Q., Trabuco, M. et al. Angew Chem Int Ed Engl (2026) 65:e17995-e17995. DOI 10.1002/anie.202517995 · PubMed

Other PDB entries of the same protein (UniProt P00720), best resolution first:

2O7A 0.84 Å, T4 lysozyme C-terminal fragment
5JDT 1.0 Å, Structure of Spin-labelled T4 lysozyme mutant L118C-R1 at 100K
7LOE 1.01 Å, T4 lysozyme mutant L99A in complex with 1-fluoranylnaphthalene
7LOD 1.02 Å, T4 lysozyme mutant L99A in complex with 1-fluoranyl-4-iodanyl-benzene
7LX8 1.03 Å, T4 lysozyme mutant L99A
5XPF 1.04 Å, High-resolution X-ray structure of the T26H mutant of T4 lysozyme
6BG3 1.05 Å, Structure of (3S,4S)-1-benzyl-4-(3-(3-(trifluoromethyl)phenyl)ureido)piperidin-3-yl…
7LOF 1.05 Å, T4 lysozyme mutant L99A in complex with 2-butylthiophene
7LX6 1.05 Å, T4 lysozyme mutant L99A
7LX7 1.05 Å, T4 lysozyme mutant L99A
1SWY 1.06 Å, Use of a Halide Binding Site to Bypass the 1000-atom Limit to Ab initio Structure…
1SWZ 1.06 Å, Use of an ion-binding site to bypass the 1000-atom limit to ab initio structure…

Browse structure collections

About this viewer

MolViewer shows 9RKG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.