9TJY: PDB entry 9TJY

Crystal Structure of the Human Oncogenic Splice Variant Rac1b Fused with the Scaffold Protein POSH (residues 319-348). Determined by X-ray diffraction at 1.77 Å resolution. Released 1 Jul 2026.

Method: X-ray diffraction
Resolution: 1.77 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,639
Mol. weight: 25.51 kDa
Ligands: GNP, MG, POL
Released: 1 Jul 2026

Explore 9TJY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9TJY contains 12 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	2-10	9	1
α-helix	16-25	10
β-strand	37-46	10	1
β-strand	49-58	10	1
α-helix	62-64	3
β-strand	96-102	7	1
α-helix	106-111	6
α-helix	112-116	5
α-helix	117-123	7
β-strand	129-134	6	1
α-helix	136-138	3
α-helix	142-150	9
α-helix	155-157	3
α-helix	158-168	11
β-strand	172-175	4	1
α-helix	184-321	16
α-helix	327-329	3
α-helix	337-340	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Isoform B of Ras-related C3 botulinum toxin substrate 1,E3 ubiquitin-protein ligase SH3RF1	A	protein	226	Homo sapiens	P63000 (AlphaFold model), Q7Z6J0 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9TJY_1 Isoform B of Ras-related C3 botulinum toxin substrate 1,E3 ubiquitin-protein ligase SH3RF1 (chains A)
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTVGETYGKDITSRGKDKPIADVFLICFSLVSPASFENVRAKWYPEV
RHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALT
QRGLKTVFDEAIRAVLQNRHSMEISPPVLISSSNPTAAARISELSG

Ligands and cofactors

ID	Name	Formula	Copies
GNP	Phosphoaminophosphonic acid-guanylate ester	C10 H17 N6 O13 P3	1
MG	Magnesium ion	Mg	1
POL	N-propanol	C3 H8 O	1

Water and common crystallization additives (CL) are not listed.

Primary citation

Alternative Splicing of a Structured Partner Alters the Folding-Upon-Binding Trajectory of an Intrinsically Disordered Protein. Kjaer, L.F., Ielasi, F.S., Winbolt, T. et al. J Am Chem Soc (2026) 148:28401-28413. DOI 10.1021/jacs.6c04072 · PubMed

Other PDB entries of the same protein (UniProt P63000 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9RFF 1.25 Å, Crystal Structure of Human Rac1 Fused with the Scaffold Protein POSH (residues 319-371)
9IFK 1.34 Å, Crystal structure of Kalirin/Rac1 in complex with DK-2
1MH1 1.38 Å, Small G-protein
9HU8 1.48 Å, Crystal structure of Kalirin/Rac1 in complex with MC-278.
2WKQ 1.6 Å, Structure of a photoactivatable Rac1 containing the Lov2 C450A Mutant
6X1G 1.6 Å, Crystal structure of a GEF domain from the Orientia tsutsugamushi protein OtDUB in…
5O33 1.64 Å, A structure of the GEF Kalirin DH1 domain in complex with the small GTPase Rac1
9IG1 1.65 Å, Crystal structure of Kalirin/Rac1 in complex with DK-652
9I1L 1.68 Å, Crystal structure of Kalirin/Rac1 in complex with RS-009
8I5V 1.73 Å, DOCK10 mutant L1903Y complexed with Rac1
1RYF 1.75 Å, Alternative Splicing of Rac1 Generates Rac1b, a Self-activating GTPase
1RYH 1.75 Å, Alternative Splicing of Rac1 Generates Rac1b, a Self-activating GTPase

Browse structure collections

About this viewer

MolViewer shows 9TJY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.