9UED: Human TRPV3

Cryo-EM structure of human TRPV3 in complex with sevoflurane determined in MSP2N2 nanodisc. Determined by electron microscopy at 3.29 Å resolution. Released 8 Apr 2026.

Method: Electron microscopy
Resolution: 3.29 Å
Organism: Homo sapiens
Chains: 4
Atoms: 20,020
Mol. weight: 374.72 kDa
Ligands: POV, A1IPI
Released: 8 Apr 2026

Explore 9UED in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9UED contains 132 α-helices and 20 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C and D: 33 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	120-129	10
α-helix	133-145	13
α-helix	158-162	5
β-strand	163-164	2	1
β-strand	169-170	2	1
α-helix	171-177	7
α-helix	183-196	14
α-helix	218-224	7
α-helix	228-237	10
α-helix	265-271	7
α-helix	277-283	7
α-helix	299-306	8
α-helix	316-327	12
α-helix	332-335	4
α-helix	336-338	3
α-helix	344-351	8
α-helix	356-361	6
α-helix	371-373	3
β-strand	377-380	4	2
β-strand	386-391	6	2
α-helix	403-408	6
α-helix	416-419	4
α-helix	423-432	10
α-helix	433-437	5
α-helix	439-459	21
α-helix	483-505	23
α-helix	521-540	20
α-helix	548-561	14
α-helix	562-568	7
α-helix	570-581	12
α-helix	582-586	5
α-helix	588-598	11
α-helix	602-608	7
α-helix	625-636	12
α-helix	644-647	4
α-helix	651-677	27
α-helix	682-706	25
β-strand	731-736	6	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transient receptor potential cation channel subfamily V member 3	A, B, C, D	protein	802	Homo sapiens	Q8NET8 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>9UED_1 Transient receptor potential cation channel subfamily V member 3 (chains A, B, C, D)
MKAHPKEMVPLMGKRVAAPSGNPAVLPEKRPAEITPTKKSAHFFLEIEGFEPNPTVAKTS
PPVFSKPMDSNIRQCISGNCDDMDSPQSPQDDVTETPSNPNSPSAQLAKEEQRRKKRRLK
KRIFAAVSEGCVEELVELLVELQELCRRRHDEDVPDFLMHKLTASDTGKTCLMKALLNIN
PNTKEIVRILLAFAEENDILGRFINAEYTEEAYEGQTALNIAIERRQGDIAALLIAAGAD
VNAHAKGAFFNPKYQHEGFYFGETPLALAACTNQPEIVQLLMEHEQTDITSRDSRGNNIL
HALVTVAEDFKTQNDFVKRMYDMILLRSGNWELETTRNNDGLTPLQLAAKMGKAEILKYI
LSREIKEKRLRSLSRKFTDWAYGPVSSSLYDLTNVDTTTDNSVLEITVYNTNIDNRHEML
TLEPLHTLLHMKWKKFAKHMFFLSFCFYFFYNITLTLVSYYRPREEEAIPHPLALTHKMG
WLQLLGRMFVLIWAMCISVKEGIAIFLLRPSDLQSILSDAWFHFVFFIQAVLVILSVFLY
LFAYKEYLACLVLAMALGWANMLYYTRGFQSMGMYSVMIQKVILHDVLKFLFVYIVFLLG
FGVALASLIEKCPKDNKDCSSYGSFSDAVLELFKLTIGLGDLNIQQNSKYPILFLFLLIT
YVILTFVLLLNMLIALMGETVENVSKESERIWRLQRARTILEFEKMLPEWLRSRFRMGEL
CKVAEDDFRLCLRINEVKWTEWKTHVSFLNEDPGPVRRTDFNKIQDSSRNNSKTTLNAFE
EVEEFPETSVAAASNSLEVLFQ

Ligands and cofactors

ID	Name	Formula	Copies
POV	(2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl…	C42 H82 N O8 P	8
A1IPI	sevoflurane	C4 H3 F7 O	4

Primary citation

Vagal nerve TRPV3 regulates sedative-mediated appeasement. Wang, P., Zhu, J., Lu, X. et al. Proc Natl Acad Sci U S A (2026) 123:e2525757123-e2525757123. DOI 10.1073/pnas.2525757123 · PubMed

Other PDB entries of the same protein (UniProt Q8NET8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6H9J 1.83 Å, Factor Inhibiting HIF (FIH) in complex with zinc, NOG and TRPV3 (229-255)
6HA6 1.98 Å, Factor Inhibiting HIF (FIH) in complex with zinc, NOG and TRPV3 (220-246)
7QQN 2.45 Å, The PDZ domain of SNTG1 complexed with the acetylated PDZ-binding motif of TRPV3
8V6K 2.46 Å, Apo-state cryo-EM structure of human TRPV3 in cNW30 nanodiscs
13LU 2.49 Å, Structure of human TRPV3-W521S Olmsted syndrome mutant in the closed state
7XJ0 2.53 Å, Structure of human TRPV3 in complex with Trpvicin
8GKA 2.55 Å, Human TRPV3 tetramer structure, closed conformation
8V6N 2.59 Å, Open-state cryo-EM structure of human TRPV3 in presence of 2-APB in cNW30 nanodiscs
9PJ5 2.76 Å, Closed-state structure of wild-type human TRPV3 purified in GDN detergent
8V6O 2.83 Å, Inactivated-state cryo-EM structure of human TRPV3 in presence of 2-APB in cNW30 nanodiscs
13LJ 2.86 Å, Structure of human TRPV3-G568C Olmsted syndrome mutant in the closed state
7XJ1 2.93 Å, Structure of human TRPV3_G573S in complex with Trpvicin in C2 symmetry

Browse structure collections

About this viewer

MolViewer shows 9UED directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.