9UL6: Lamin A/C Ig-like domain mutant - R435C

Crystal structure of Lamin A/C Ig-like domain mutant - R435C. Determined by X-ray diffraction at 2.5 Å resolution. Released 29 Apr 2026.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 3
Atoms: 3,036
Mol. weight: 48.4 kDa
Released: 29 Apr 2026

Explore 9UL6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9UL6 contains 4 α-helices and 36 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 12 β-strands

Element	Residues	Length	Sheet
β-strand	426-436	11	4
β-strand	440-445	6	5
β-strand	451-456	6	5
β-strand	462-463	2	6
β-strand	468-472	5	4
α-helix	477-478	2
β-strand	479-482	4	4
β-strand	488-489	2	6
β-strand	494-499	6	5
β-strand	507	1	5
β-strand	511-514	4	5
β-strand	525-531	7	4
β-strand	537-549	13	4

Chain B: 1 helix, 12 β-strands

Element	Residues	Length	Sheet
β-strand	424-436	13	1
β-strand	440-445	6	7
β-strand	451-456	6	7
β-strand	462-463	2	8
β-strand	468-473	6	1
α-helix	477-478	2
β-strand	479-482	4	1
β-strand	488-489	2	8
β-strand	494-499	6	7
β-strand	507	1	7
β-strand	511-514	4	7
β-strand	525-531	7	1
β-strand	537-549	13	1

Chain C: 2 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	424-436	13	1
β-strand	440-445	6	2
β-strand	451-456	6	2
β-strand	462-463	2	3
β-strand	468-472	5	1
α-helix	477-478	2
β-strand	479-482	4	1
β-strand	488-489	2	3
β-strand	494-499	6	2
β-strand	507	1	2
β-strand	511-514	4	2
β-strand	525-531	7	1
β-strand	537-549	13	1
α-helix	550-551	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Lamin-A/C	A, B, C	protein	147	Homo sapiens	P02545 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>9UL6_1 Lamin-A/C (chains A, B, C)
SSQTQGGGSVTKKRKLESTESRSSFSQHACTSGRVAVEEVDEEGKFVRLRNKSNEDQSMG
NWQIKRQNGDDPLLTYRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNS
LRTALINSTGEEVAMRKLVRSVTVVED

Primary citation

Lamin A/C Ig-like domain mutant - R435C. Lee, J., Ha, N.C. To be published.

Other PDB entries of the same protein (UniProt P02545 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7WZZ 1.3 Å, Crystal structure of peptide KAGQVVTIW in complex with HLA-B5801
7X1B 1.4 Å, Crystal structure of peptide KAGQVVTI in complex with HLA-B5801
1IFR 1.4 Å, Structure of Lamin A/C Globular Domain
3GEF 1.5 Å, Crystal structure of the R482W mutant of lamin A/C
8I33 1.62 Å, Coil 1a of lamin A (residue 25-65)
7Z21 1.63 Å, BAF A12T bound to the lamin A/C Ig-fold domain
7CRG 1.8 Å, Beta-strand-mediated dimeric formation of the extended Ig-like domains of human lamin A/C
7X5D 1.82 Å, Crystal Structure of the K316C mutant of Human Lamin A/C Coil 2 (residues 244-340)
6YF5 1.83 Å, Lamin A 17-70 coil1A dimer stabilized by C-terminal capping
6GHD 2.1 Å, Structural analysis of the ternary complex between lamin A/C, BAF and emerin identifies…
7YVD 2.1 Å, The crystal structure of the progerin C-terminal peptide and the Ig-like domain of lamin…
1X8Y 2.2 Å, Human lamin coil 2B

Browse structure collections

About this viewer

MolViewer shows 9UL6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.