9UUJ: Mu2 subunit of the clathrin-adaptor protein 2

Crystal structure of the mu2 subunit of the clathrin-adaptor protein 2 (AP2) bound to HPV16 E7(residues 22-39). Determined by X-ray diffraction at 3.7 Å resolution. Released 10 Sept 2025.

Method: X-ray diffraction
Resolution: 3.7 Å
Organisms: Rattus norvegicus, Human papillomavirus 16
Chains: 2
Atoms: 1,989
Mol. weight: 34.32 kDa
Released: 10 Sept 2025

Explore 9UUJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9UUJ contains 5 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	172-185	14	1
β-strand	191-205	15	1
β-strand	211-216	6	2
β-strand	245-248	4	1
β-strand	252	1	2
β-strand	264-265	2	2
α-helix	267-268	2
β-strand	270-279	10	1
β-strand	287-296	10	3
β-strand	300-309	10	3
β-strand	316-325	10	1
α-helix	326-327	2
β-strand	330-337	8	3
β-strand	341-345	5	1
β-strand	350-359	10	1
β-strand	363-372	10	3
α-helix	377-379	3
α-helix	384-385	2
β-strand	386-392	7	1
β-strand	401-407	7	2
α-helix	415-417	3
β-strand	419-433	15	1

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	26-27	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
AP-2 complex subunit mu	A	protein	281	Rattus norvegicus	P84092 (AlphaFold model)
Protein E7	B	protein	18	Human papillomavirus 16	P03129 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9UUJ_1 AP-2 complex subunit mu (chains A)
GHMQIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKF
GMNDKIVIEKQGKGTADETSKSGKQSIAIDDCTFHQCVRLSKFDSERSISFIPPDGEFEL
MRYRTTKDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQ
VICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPTNDKKKWARPPISMNFEVPF
APSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC

Sequence of entity 2 (B), FASTA

>9UUJ_2 Protein E7 (chains B)
LYCYEQLNDSSEEEDEID

Primary citation

Crystal structures of the mu 2 subunit of clathrin-adaptor protein 2 in complex with peptides derived from human papillomavirus 16 E7. Jung, S., Lim, D., Choi, J.S. et al. J Microbiol (2025) 63:e2505003-e2505003. DOI 10.71150/jm.2505003 · PubMed

Other PDB entries of the same protein (UniProt P84092 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7OIQ 1.85 Å, Crystal structure of AP2 Mu2 in complex with FCHO2 WxxPhi motif (C2 crystal form)
7OFP 1.92 Å, Apo Structure of Mu2 Adaptin Subunit (Ap50) Of AP2 Clathrin Adaptor
7OHZ 2.27 Å, Crystal structure of AP2 Mu2 - FCHO2 chimera (His6-tagged)
1I31 2.5 Å, MU2 adaptin subunit (AP50) of AP2 clathrin adaptor, complexed with EGFR internalization…
2PR9 2.51 Å, Mu2 adaptin subunit (AP50) of AP2 adaptor (second domain), complexed with GABAA…
6QH5 2.56 Å, AP2 clathrin adaptor mu2T156-phosphorylated core in closed conformation
5WRM 2.6 Å, Mu2 subunit of the clathrin adaptor complex AP2 in complex with IRS-1 Y658 peptide
2VGL 2.6 Å, AP2 clathrin adaptor core
3H85 2.6 Å, Molecular basis for the association of PIPKI gamma-p90 with the clathrin adaptor AP-2
7OI5 2.61 Å, Crystal structure of AP2 Mu2 - FCHO2 chimera (GST cleaved)
5WRK 2.62 Å, Mu2 subunit of the clathrin adaptor complex AP2 in complex with IRS-1 Y608 peptide
1BW8 2.65 Å, MU2 adaptin subunit (AP50) of AP2 adaptor (second domain), complexed with EGFR…

Browse structure collections

About this viewer

MolViewer shows 9UUJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.