9UXB: Transcription activator BRG1

The apo structure of BCL7B-containing ARP module of the human SWI/SNF complex. Determined by electron microscopy at 2.92 Å resolution. Released 6 May 2026.

Method: Electron microscopy
Resolution: 2.92 Å
Organism: Homo sapiens
Chains: 4
Atoms: 6,709
Mol. weight: 124.56 kDa
Ligands: MG, ATP
Released: 6 May 2026

Explore 9UXB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9UXB contains 46 α-helices and 45 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	465-513	49

Chain B: 22 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	8-12	5	1
β-strand	16-21	6	1
β-strand	29-32	4	1
β-strand	35	1	2
β-strand	54	1	2
α-helix	56-60	5
β-strand	68	1	2
β-strand	71-72	2	3
β-strand	75-76	2	3
α-helix	82-87	6
α-helix	88-93	6
α-helix	98-100	3
β-strand	103-107	5	1
α-helix	113-125	13
β-strand	131-136	6	1
α-helix	137-145	9
β-strand	150-155	6	4
β-strand	160-166	7	4
β-strand	169-170	2	4
β-strand	176-178	3	4
α-helix	182-194	13
α-helix	203-216	14
α-helix	223-226	4
β-strand	238-242	5	5
β-strand	246-250	5	5
α-helix	252-255	4
α-helix	258-261	4
α-helix	264-267	4
α-helix	274-283	10
α-helix	287-295	9
β-strand	297-300	4	4
α-helix	303-305	3
α-helix	309-320	12
β-strand	329-330	2	4
α-helix	335-337	3
α-helix	338-346	9
α-helix	352-354	3
β-strand	357-358	2	1
α-helix	359-365	7
α-helix	366-368	3
α-helix	370-373	4

Chain C: 23 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	14-17	4	6
β-strand	22-27	6	6
β-strand	35-38	4	6
β-strand	41	1	7
β-strand	42-44	3	8
β-strand	67-69	3	8
α-helix	71-75	5
β-strand	85	1	7
β-strand	88-89	2	9
β-strand	92-93	2	9
α-helix	96-105	10
α-helix	106-111	6
β-strand	120-124	5	6
α-helix	130-139	10
α-helix	140-144	5
β-strand	148-153	6	6
α-helix	154-161	8
β-strand	167-171	5	10
β-strand	177-183	7	10
β-strand	186-187	2	10
β-strand	193-195	3	10
α-helix	199-212	14
α-helix	220-222	3
β-strand	223-226	4	11
β-strand	237-239	3	11
α-helix	240	1
α-helix	244-247	4
α-helix	248-265	18
β-strand	268	1	12
α-helix	276-280	5
α-helix	283-284	2
β-strand	285-288	4	13
β-strand	294-297	4	13
α-helix	306-309	4
α-helix	325-334	10
α-helix	338-340	3
α-helix	341-345	5
β-strand	348-351	4	10
α-helix	353-356	4
β-strand	358	1	12
α-helix	360-371	12
β-strand	380	1	10
α-helix	386-390	5
α-helix	392-401	10
β-strand	411-412	2	6
α-helix	413-417	5
α-helix	423-427	5

Chain D: 0 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	31-37	7	14
β-strand	44-50	7	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription activator BRG1	A	protein	101	Homo sapiens	P51532 (AlphaFold model)
Actin, cytoplasmic 1, N-terminally processed	B	protein	376	Homo sapiens	P60709 (AlphaFold model)
Actin-like protein 6A	C	protein	430	Homo sapiens	O96019 (AlphaFold model)
B-cell CLL/lymphoma 7 protein family member B	D	protein	203	Homo sapiens	Q9BQE9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9UXB_1 Transcription activator BRG1 (chains A)
MSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVTGKIQKLTKAV
ATYHANTEREQKKWSHPQFEKGGGSGGGSGGGSWSHPQFEK

Sequence of entity 2 (B), FASTA

>9UXB_2 Actin, cytoplasmic 1, N-terminally processed (chains B)
MADDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLD
LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKS
YELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVL
SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK
QEYDESGPSIVHRKCF

Sequence of entity 3 (C), FASTA

>9UXB_3 Actin-like protein 6A (chains C)
MASGGVYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVERDDGSTLMEIDGD
KGKQGGPTYYIDTNALRVPRENMEAISPLKNGMVEDWDSFQAILDHTYKMHVKSEASLHP
VLMSEAPWNTRAKREKLTELMFEHYNIPAFFLCKTAVLTAFANGRSTGLILDSGATHTTA
IPVHDGYVLQQGIVKSPLAGDFITMQCRELFQEMNIELVPPYMIASKEAVREGSPANWKR
KEKLPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAAQMPTVHYEFPNGYNCDFGA
ERLKIPEGLFDPSNVKGLSGNTMLGVSHVVTTSVGMCDIDIRPGLYGSVIVAGGNTLIQS
FTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQEYEEG
GKQCVERKCP

Sequence of entity 4 (D), FASTA

>9UXB_4 B-cell CLL/lymphoma 7 protein family member B (chains D)
MASGRSVRAETRSRAKDDIKKVMAAIEKVRKWEKKWVTVGDTSLRIFKWVPVTDSKEKEK
SKSNSSAAREPNGFPSDASANSSLLLEFQDENSNQSSVSDVYQLKVDSSTNSSPSPQQSE
SLSPAHTSDFRTDDSQPPTLGQEILEEPSLPSSEVADEPPTLTKEEPVPLETQVVEEEED
SGAPPLKRFCVDQPTVPQTASES

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	2
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	2

Primary citation

Structural basis for BCL7B-mediated ncBAF-nucleosome engagement. Sun, F., Zou, B., Li, H. et al. Nucleic Acids Res (2026) 54. DOI 10.1093/nar/gkag092 · PubMed

Other PDB entries of the same protein (UniProt P51532 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7TAB 1.16 Å, G-925 bound to the SMARCA4 (BRG1) Bromodomain
2GRC 1.5 Å, 1.5 A structure of bromodomain from human BRG1 protein, a central ATPase of SWI/SNF…
6ZS2 1.57 Å, Crystal Structure of the bromodomain of human transcription activator BRG1 (SMARCA4) in…
7TD9 1.61 Å, G-059 bound to the SMARCA4 (BRG1) Bromodomain
6HR2 1.76 Å, Crystal structure of PROTAC 2 in complex with the bromodomain of human SMARCA4 and…
3UVD 1.85 Å, Crystal Structure of the bromodomain of human Transcription activator BRG1 (SMARCA4) in…
5DKD 2.0 Å, Crystal structure of the bromodomain of human BRG1 (SMARCA4) in complex with PFI-3…
5EA1 2.0 Å, Crystal Structure of SMARCA4 bromodomain in complex with MPD
9DTX 2.11 Å, Crystal structure of PRT3789 in complex with the bromodomain of human BRG1 (SMARCA4) and…
7VRB 2.39 Å, Structure of the Human BRG1/SS18 complex
9UXC 2.74 Å, The ADP-bound structure of BCL7B-containing ARP module of the human SWI/SNF complex
7VDT 2.8 Å, The motor-nucleosome module of human chromatin remodeling PBAF-nucleosome complex

Browse structure collections

About this viewer

MolViewer shows 9UXB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.