9UYH: G protein-coupled receptor 1

Cryo-EM structure of the G protein-coupled receptor 1 (GPR1) bound to chemerin and beta-arrestin 1 (Conformation 1). Determined by electron microscopy at 3.3 Å resolution. Released 19 Nov 2025.

Method: Electron microscopy
Resolution: 3.3 Å
Organisms: Homo sapiens, Escherichia phage EcSzw-2
Chains: 5
Atoms: 7,176
Mol. weight: 145.28 kDa
Released: 19 Nov 2025

Explore 9UYH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9UYH contains 25 α-helices and 72 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 33 β-strands

Element	Residues	Length	Sheet
β-strand	8-12	5	1
β-strand	19-22	4	1
β-strand	27-28	2	2
α-helix	34-36	3
β-strand	37	1	3
β-strand	40-42	3	1
β-strand	53-62	10	4
α-helix	65-67	3
β-strand	78-85	8	4
α-helix	95-97	3
α-helix	99-108	10
β-strand	112-114	3	1
β-strand	117	1	3
α-helix	123-125	3
β-strand	127-129	3	4
β-strand	140-150	11	4
β-strand	163-167	5	4
β-strand	170-171	2	2
α-helix	178-182	5
β-strand	183-186	4	5
β-strand	198-203	6	5
β-strand	207-208	2	6
β-strand	214-215	2	7
β-strand	216-217	2	5
β-strand	220-221	2	5
β-strand	230-239	10	8
β-strand	242	1	9
β-strand	246	1	9
β-strand	249	1	8
β-strand	252-258	7	8
β-strand	267-268	2	5
β-strand	273-274	2	7
β-strand	288-290	3	4
β-strand	300	1	4
α-helix	301-304	4
β-strand	316	1	9
β-strand	319-328	10	8
β-strand	345-349	5	8
β-strand	350-351	2	6
α-helix	353-356	4
β-strand	367	1	10

Chain B: 1 helix, 10 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	11
β-strand	11	1	12
β-strand	20-23	4	11
β-strand	34-39	6	13
β-strand	45-49	5	13
β-strand	67-72	6	11
β-strand	77-82	6	11
α-helix	87-89	3
β-strand	91-97	7	13
β-strand	108-110	3	13
β-strand	111	1	12

Chain C: 2 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	5-6	2	15
β-strand	11-12	2	16
β-strand	20-23	4	17
β-strand	25-26	2	15
β-strand	34-39	6	16
β-strand	46-49	4	16
β-strand	55	1	16
α-helix	56	1
β-strand	57	1	18
β-strand	59	1	18
β-strand	63-66	4	17
β-strand	73-76	4	17
β-strand	86-91	6	16
β-strand	94	1	10
β-strand	98	1	16
β-strand	103-105	3	16
β-strand	127-131	5	19
β-strand	143-149	7	19
β-strand	156-163	8	20
β-strand	169-176	8	20
β-strand	181-184	4	20
β-strand	192-197	6	19
β-strand	202-207	6	19
α-helix	212-214	3
β-strand	216	1	21
β-strand	217-224	8	20
β-strand	231-233	3	20
β-strand	240	1	21

Chain R: 14 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	38-61	24
α-helix	62-66	5
α-helix	71-88	18
α-helix	90-96	7
α-helix	99-101	3
α-helix	110-138	29
α-helix	151-168	18
β-strand	176-181	6	14
β-strand	184-189	6	14
α-helix	201-216	16
α-helix	218-222	5
α-helix	223-227	5
α-helix	228-230	3
α-helix	242-272	31
α-helix	288-304	17
α-helix	309-316	8
β-strand	1361-1363	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Retinoic acid receptor responder protein 2	L	protein	153	Homo sapiens	Q99969 (AlphaFold model)
Beta-arrestin-1	A	protein	376	Homo sapiens	P49407 (AlphaFold model)
Nanobody 32	B	protein	120	Escherichia phage EcSzw-2
Chemerin-like receptor 2,Vasopressin V2 receptor	R	protein	396	Homo sapiens	P30518 (AlphaFold model), P46091 (AlphaFold model)
Single-chain fragment variable 30 (scFv30)	C	protein	245	Homo sapiens

Sequence of entity 1 (L), FASTA

>9UYH_1 Retinoic acid receptor responder protein 2 (chains L)
MKTIIALSYIFCLVFAELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGI
FVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVL
REAEEHQETQCLRVQRAGEDPHSFYFPGQFAFS

Sequence of entity 2 (A), FASTA

>9UYH_2 Beta-arrestin-1 (chains A)
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTAA
FRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIP
PNLPSSVTLQPGPEDTGKAIGVDYEVKAFVAENLEEKIHKRNSVRLVIEKVQYAPERPGP
QPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYAD
IVLFNTAQYKVPVAMEEADDTVAPSSTFSKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEP
PHREVPENETPVDTNL

Sequence of entity 3 (B), FASTA

>9UYH_3 Nanobody 32 (chains B)
QVQLQESGGGLVQAGGSLRLSCVVSGFFFDTVTMAWYRRAPGKHRELVASATAGGTTTYA
DSVKDRFTISRDNAKNTVYLQMNSLKPEDTAVYYCNTFVRSLSWGQGTQVTVSSHHHHHH

Sequence of entity 4 (R), FASTA

>9UYH_4 Chemerin-like receptor 2,Vasopressin V2 receptor (chains R)
WSHPQFEKGSGAGASAGSWSHPQFEKGSDYKDDDDKEFLEVLFQGPEDLEETLFEEFENY
SYDLDYYSLESDLEEKVQLGVVHWVSLVLYCLAFVLGIPGNAIVIWFTGFKWKKTVTTLW
FLNLAIADFIFLLFLPLYISYVAMNFHWPFGIWLCKANSFTAQLNMFASVFFLTVISLDH
YIHLIHPVLSHRHRTLKNSLIVIIFIWLLASLIGGPALYFRDTVEFNNHTLCYNNFQKHD
PDLTLIRHHVLTWVKFIIGYLFPLLTMSICYLCLIFKVKKRSILISSRHFWTILVVVVAF
VVCWTPYHLFSIWELTIHHNSYSHHVMQAGIPLSTGLAFLNSCLNPILYVLISKKFQARF
RSSVAEIARGRTPPSLGPQDESCTTASSSLAKDTSS

Sequence of entity 5 (C), FASTA

>9UYH_5 Single-chain fragment variable 30 (scFv30) (chains C)
SDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVP
SRFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFGQGTKVEIKGTTAASGSSGGS
SSGAEVQLVESGGGLVQPGGSLRLSCAASGFNVYSSSIHWVRQAPGKGLEWVASISSYYG
YTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSRQFWYSGLDYWGQGTLV
TVSSA

Primary citation

Noncanonical agonist-dependent and -independent arrestin recruitment of GPR1. Cai, H., Lin, X., Zhao, L. et al. Science (2025) 390:eadt8794-eadt8794. DOI 10.1126/science.adt8794 · PubMed

Other PDB entries of the same protein (UniProt Q99969 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7YKD 2.81 Å, Cryo-EM structure of the human chemerin receptor 1 complex with the C-terminal…
8JJP 2.9 Å, G protein-coupled receptor 1
8SG1 2.94 Å, Cryo-EM structure of CMKLR1 signaling complex
8ZJG 3.18 Å, Cryo-EM structure of human CMKLR1-Gi complex bound to chemerin
9UYI 3.2 Å, Cryo-EM structure of the G protein-coupled receptor 1 (GPR1) bound to chemerin and…
8XGM 3.29 Å, Cryo-EM structure of human GPR1 bound to chemerin
9UYJ 3.3 Å, Cryo-EM structure of the G protein-coupled receptor 1 (GPR1) bound to chemerin and…
9UYL 3.3 Å, Cryo-EM structure of the G protein-coupled receptor 1 (GPR1) bound to chemerin and…
9L3W 3.5 Å, Cryo-EM structure of the chemokine-like receptor 1 in complex with chemerin and Gi1
9UYM 3.5 Å, Composite map of the G protein-coupled receptor 1 (GPR1) bound to chemerin and…
9L3Y 3.6 Å, Cryo-EM structure of the G-protein coupled receptor 1 (GPR1) in complex with chemerin…

Browse structure collections

About this viewer

MolViewer shows 9UYH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.