9UYI: G protein-coupled receptor 1

Cryo-EM structure of the G protein-coupled receptor 1 (GPR1) bound to chemerin and beta-arrestin 1 (Conformation 2). Determined by electron microscopy at 3.2 Å resolution. Released 19 Nov 2025.

Method: Electron microscopy
Resolution: 3.2 Å
Organisms: Homo sapiens, Escherichia phage EcSzw-2
Chains: 5
Atoms: 7,150
Mol. weight: 145.36 kDa
Released: 19 Nov 2025

Explore 9UYI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9UYI contains 18 α-helices and 67 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	9-11	3	1
β-strand	19-22	4	1
β-strand	27-28	2	2
β-strand	29	1	3
β-strand	34	1	3
α-helix	35-36	2
β-strand	38-42	5	1
β-strand	53-62	10	4
β-strand	78-81	4	4
β-strand	84-85	2	4
α-helix	99-108	10
β-strand	112-116	5	1
β-strand	127-129	3	4
β-strand	141-150	10	4
β-strand	164-166	3	4
β-strand	170-171	2	2
α-helix	180-182	3
β-strand	183-184	2	5
β-strand	200-203	4	5
β-strand	207-208	2	6
β-strand	214-219	6	5
β-strand	222	1	7
β-strand	228-242	15	8
β-strand	246	1	8
β-strand	249-255	7	8
β-strand	266	1	7
β-strand	271-274	4	5
β-strand	288-290	3	4
β-strand	300	1	4
α-helix	301-305	5
β-strand	316-329	14	8
β-strand	343-349	7	8
β-strand	350-351	2	6
β-strand	367	1	9

Chain B: 1 helix, 10 β-strands

Element	Residues	Length	Sheet
β-strand	6-7	2	10
β-strand	10-12	3	11
β-strand	20-23	4	10
β-strand	34-39	6	12
β-strand	45-49	5	12
β-strand	67-72	6	10
β-strand	77-82	6	10
α-helix	87-89	3
β-strand	92-97	6	12
β-strand	108-109	2	12
β-strand	110-112	3	11

Chain C: 1 helix, 24 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	14
β-strand	11-12	2	15
β-strand	20-23	4	16
β-strand	24-26	3	14
β-strand	34-39	6	15
β-strand	46-49	4	15
β-strand	55	1	15
β-strand	64-66	3	16
β-strand	73-76	4	16
α-helix	81-83	3
β-strand	86-91	6	15
β-strand	94	1	9
β-strand	98-99	2	15
β-strand	103-105	3	15
β-strand	127-131	5	17
β-strand	141-149	9	17
β-strand	156-163	8	15
β-strand	169-176	8	15
β-strand	181-184	4	15
β-strand	192-197	6	17
β-strand	202-208	7	17
β-strand	216	1	18
β-strand	217-224	8	15
β-strand	231-233	3	15
β-strand	240	1	18

Chain R: 12 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	37-60	24
α-helix	71-98	28
α-helix	110-140	31
α-helix	151-173	23
β-strand	177-181	5	13
β-strand	184-188	5	13
α-helix	204-210	7
α-helix	211-216	6
α-helix	217-226	10
α-helix	227-231	5
α-helix	243-272	30
α-helix	273-277	5
α-helix	286-304	19
α-helix	308-315	8
β-strand	1361-1362	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Retinoic acid receptor responder protein 2	L	protein	153	Homo sapiens	Q99969 (AlphaFold model)
Beta-arrestin-1	A	protein	376	Homo sapiens	P49407 (AlphaFold model)
Nanobody 32	B	protein	120	Escherichia phage EcSzw-2
Chemerin-like receptor 2,Vasopressin V2 receptor	R	protein	396	Homo sapiens	P30518 (AlphaFold model), P46091 (AlphaFold model)
Single-chain fragment variable 30 (scFv30)	C	protein	245	Homo sapiens

Sequence of entity 1 (L), FASTA

>9UYI_1 Retinoic acid receptor responder protein 2 (chains L)
MKTIIALSYIFCLVFAELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGI
FVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVL
REAEEHQETQCLRVQRAGEDPHSFYFPGQFAFS

Sequence of entity 2 (A), FASTA

>9UYI_2 Beta-arrestin-1 (chains A)
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTAA
FRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIP
PNLPSSVTLQPGPEDTGKAIGVDYEVKAFVAENLEEKIHKRNSVRLVIEKVQYAPERPGP
QPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYAD
IVLFNTAQYKVPVAMEEADDTVAPSSTFSKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEP
PHREVPENETPVDTNL

Sequence of entity 3 (B), FASTA

>9UYI_3 Nanobody 32 (chains B)
QVQLQESGGGLVQAGGSLRLSCVVSGFFFDTVTMAWYRRAPGKHRELVASATAGGTTTYA
DSVKDRFTISRDNAKNTVYLQMNSLKPEDTAVYYCNTFVRSLSWGQGTQVTVSSHHHHHH

Sequence of entity 4 (R), FASTA

>9UYI_4 Chemerin-like receptor 2,Vasopressin V2 receptor (chains R)
WSHPQFEKGSGAGASAGSWSHPQFEKGSDYKDDDDKEFLEVLFQGPEDLEETLFEEFENY
SYDLDYYSLESDLEEKVQLGVVHWVSLVLYCLAFVLGIPGNAIVIWFTGFKWKKTVTTLW
FLNLAIADFIFLLFLPLYISYVAMNFHWPFGIWLCKANSFTAQLNMFASVFFLTVISLDH
YIHLIHPVLSHRHRTLKNSLIVIIFIWLLASLIGGPALYFRDTVEFNNHTLCYNNFQKHD
PDLTLIRHHVLTWVKFIIGYLFPLLTMSICYLCLIFKVKKRSILISSRHFWTILVVVVAF
VVCWTPYHLFSIWELTIHHNSYSHHVMQAGIPLSTGLAFLNSCLNPILYVLISKKFQARF
RSSVAEIARGRTPPSLGPQDESCTTASSSLAKDTSS

Sequence of entity 5 (C), FASTA

>9UYI_5 Single-chain fragment variable 30 (scFv30) (chains C)
SDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVP
SRFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFGQGTKVEIKGTTAASGSSGGS
SSGAEVQLVESGGGLVQPGGSLRLSCAASGFNVYSSSIHWVRQAPGKGLEWVASISSYYG
YTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSRQFWYSGLDYWGQGTLV
TVSSA

Primary citation

Noncanonical agonist-dependent and -independent arrestin recruitment of GPR1. Cai, H., Lin, X., Zhao, L. et al. Science (2025) 390:eadt8794-eadt8794. DOI 10.1126/science.adt8794 · PubMed

Other PDB entries of the same protein (UniProt Q99969 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7YKD 2.81 Å, Cryo-EM structure of the human chemerin receptor 1 complex with the C-terminal…
8JJP 2.9 Å, G protein-coupled receptor 1
8SG1 2.94 Å, Cryo-EM structure of CMKLR1 signaling complex
8ZJG 3.18 Å, Cryo-EM structure of human CMKLR1-Gi complex bound to chemerin
8XGM 3.29 Å, Cryo-EM structure of human GPR1 bound to chemerin
9UYH 3.3 Å, Cryo-EM structure of the G protein-coupled receptor 1 (GPR1) bound to chemerin and…
9UYJ 3.3 Å, Cryo-EM structure of the G protein-coupled receptor 1 (GPR1) bound to chemerin and…
9UYL 3.3 Å, Cryo-EM structure of the G protein-coupled receptor 1 (GPR1) bound to chemerin and…
9L3W 3.5 Å, Cryo-EM structure of the chemokine-like receptor 1 in complex with chemerin and Gi1
9UYM 3.5 Å, Composite map of the G protein-coupled receptor 1 (GPR1) bound to chemerin and…
9L3Y 3.6 Å, Cryo-EM structure of the G-protein coupled receptor 1 (GPR1) in complex with chemerin…

Browse structure collections

About this viewer

MolViewer shows 9UYI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.