9UYL: G protein-coupled receptor 1

Cryo-EM structure of the G protein-coupled receptor 1 (GPR1) bound to chemerin and beta-arrestin 1 (Conformation 4). Determined by electron microscopy at 3.3 Å resolution. Released 19 Nov 2025.

Method: Electron microscopy
Resolution: 3.3 Å
Organisms: Homo sapiens, Escherichia phage EcSzw-2
Chains: 5
Atoms: 6,588
Mol. weight: 145.36 kDa
Released: 19 Nov 2025

Explore 9UYL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9UYL contains 20 α-helices and 70 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 31 β-strands

Element	Residues	Length	Sheet
β-strand	9-11	3	2
β-strand	19-22	4	2
β-strand	26-28	3	3
β-strand	29	1	4
β-strand	34	1	4
α-helix	35-36	2
β-strand	37-42	6	2
β-strand	53-60	8	5
β-strand	62	1	6
β-strand	76	1	6
β-strand	81-85	5	5
α-helix	99-108	10
β-strand	112-117	6	2
β-strand	128-129	2	7
α-helix	130-131	2
β-strand	141	1	7
β-strand	143-150	8	5
α-helix	160-162	3
β-strand	166-168	3	5
β-strand	169-171	3	3
α-helix	178-182	5
β-strand	183-186	4	8
β-strand	199-203	5	8
β-strand	207-208	2	9
β-strand	214-217	4	8
β-strand	220	1	8
β-strand	231-241	11	10
β-strand	249-258	10	10
β-strand	268	1	8
β-strand	271-274	4	8
β-strand	288-289	2	7
β-strand	300	1	7
α-helix	301-304	4
β-strand	317-327	11	10
β-strand	343-349	7	10
β-strand	350-351	2	9
β-strand	367	1	11

Chain B: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	12
β-strand	11-12	2	13
β-strand	20	1	14
β-strand	23	1	12
β-strand	34-39	6	15
β-strand	45-47	3	15
β-strand	67-72	6	14
β-strand	77-82	6	14
α-helix	87-89	3
β-strand	91-97	7	15
β-strand	108-110	3	15
β-strand	111-112	2	13

Chain C: 2 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	5-6	2	16
β-strand	11-12	2	17
β-strand	20-23	4	18
β-strand	25-26	2	16
β-strand	34-38	5	19
β-strand	46-49	4	19
β-strand	55	1	19
β-strand	64-66	3	18
β-strand	73-76	4	18
α-helix	81-83	3
β-strand	86-87	2	17
β-strand	88-91	4	19
β-strand	94	1	11
β-strand	99	1	19
β-strand	103-105	3	17
β-strand	128-131	4	20
β-strand	141-148	8	20
β-strand	156-163	8	21
β-strand	169-176	8	21
β-strand	181-184	4	21
β-strand	192-197	6	20
β-strand	202-208	7	20
α-helix	212-214	3
β-strand	216	1	22
β-strand	217-224	8	21
β-strand	231-233	3	21
β-strand	240	1	22

Chain R: 11 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	43-64	22
α-helix	71-87	17
α-helix	90-97	8
α-helix	106-108	3
α-helix	110-140	31
α-helix	151-173	23
β-strand	179	1	1
β-strand	188	1	1
α-helix	203-211	9
α-helix	212-216	5
α-helix	217-226	10
α-helix	253-275	23
α-helix	286-303	18
β-strand	1360-1362	3	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chemerin-like receptor 2,Vasopressin V2 receptor	R	protein	396	Homo sapiens	P30518 (AlphaFold model), P46091 (AlphaFold model)
Retinoic acid receptor responder protein 2	L	protein	153	Homo sapiens	Q99969 (AlphaFold model)
Beta-arrestin-1	A	protein	376	Homo sapiens	P49407 (AlphaFold model)
Nanobody 32	B	protein	120	Escherichia phage EcSzw-2
Single-chain fragment variable 30 (scFv30)	C	protein	245	Homo sapiens

Sequence of entity 1 (R), FASTA

>9UYL_1 Chemerin-like receptor 2,Vasopressin V2 receptor (chains R)
WSHPQFEKGSGAGASAGSWSHPQFEKGSDYKDDDDKEFLEVLFQGPEDLEETLFEEFENY
SYDLDYYSLESDLEEKVQLGVVHWVSLVLYCLAFVLGIPGNAIVIWFTGFKWKKTVTTLW
FLNLAIADFIFLLFLPLYISYVAMNFHWPFGIWLCKANSFTAQLNMFASVFFLTVISLDH
YIHLIHPVLSHRHRTLKNSLIVIIFIWLLASLIGGPALYFRDTVEFNNHTLCYNNFQKHD
PDLTLIRHHVLTWVKFIIGYLFPLLTMSICYLCLIFKVKKRSILISSRHFWTILVVVVAF
VVCWTPYHLFSIWELTIHHNSYSHHVMQAGIPLSTGLAFLNSCLNPILYVLISKKFQARF
RSSVAEIARGRTPPSLGPQDESCTTASSSLAKDTSS

Sequence of entity 2 (L), FASTA

>9UYL_2 Retinoic acid receptor responder protein 2 (chains L)
MKTIIALSYIFCLVFAELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGI
FVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVL
REAEEHQETQCLRVQRAGEDPHSFYFPGQFAFS

Sequence of entity 3 (A), FASTA

>9UYL_3 Beta-arrestin-1 (chains A)
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTAA
FRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIP
PNLPSSVTLQPGPEDTGKAIGVDYEVKAFVAENLEEKIHKRNSVRLVIEKVQYAPERPGP
QPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYAD
IVLFNTAQYKVPVAMEEADDTVAPSSTFSKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEP
PHREVPENETPVDTNL

Sequence of entity 4 (B), FASTA

>9UYL_4 Nanobody 32 (chains B)
QVQLQESGGGLVQAGGSLRLSCVVSGFFFDTVTMAWYRRAPGKHRELVASATAGGTTTYA
DSVKDRFTISRDNAKNTVYLQMNSLKPEDTAVYYCNTFVRSLSWGQGTQVTVSSHHHHHH

Sequence of entity 5 (C), FASTA

>9UYL_5 Single-chain fragment variable 30 (scFv30) (chains C)
SDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVP
SRFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFGQGTKVEIKGTTAASGSSGGS
SSGAEVQLVESGGGLVQPGGSLRLSCAASGFNVYSSSIHWVRQAPGKGLEWVASISSYYG
YTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSRQFWYSGLDYWGQGTLV
TVSSA

Primary citation

Noncanonical agonist-dependent and -independent arrestin recruitment of GPR1. Cai, H., Lin, X., Zhao, L. et al. Science (2025) 390:eadt8794-eadt8794. DOI 10.1126/science.adt8794 · PubMed

Other PDB entries of the same protein (UniProt P30518 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7DFC 2.49 Å, Crystal of Arrestin2-V2Rpp-3-Fab30 complex
9HAP 2.5 Å, Cryo-EM structure of inactive human arginine-vasopressin (AVP) V2 receptor (V2R) with…
9HB3 2.5 Å, cryo-EM structure of inactive human arginine-vasopressin (AVP) V2 receptor (V2R) with…
7DFA 2.54 Å, Crystal of Arrestin2-V2Rpp-4-Fab30 complex
4JQI 2.6 Å, Structure of active beta-arrestin1 bound to a G protein-coupled receptor phosphopeptide
7DW9 2.6 Å, Cryo-EM structure of human V2 vasopressin receptor in complex with an Gs protein
9ZZO 2.6 Å, MP1104-bound Kappa Opioid Receptor in complex with beta-arrestin1
22GM 2.7 Å, C5a bound C5aR1 in complex with beta-arrestin1
7KH0 2.8 Å, Cryo-EM structure of the human arginine vasopressin AVP-vasopressin receptor V2R-Gs…
9WSV 2.8 Å, Cryo-EM structure of DAMGO-muOR-arrestin-1-Fab30 complex
9WSW 2.8 Å, Cryo-EM structure of endomorphin-1-muOR-Gz-scFv16 complex
9WSX 2.8 Å, Cryo-EM structure of endomorphin-1-muOR-arrestin2-Fab30 complex

Browse structure collections

About this viewer

MolViewer shows 9UYL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.