9VWE: RSV pre-F

Cryo-EM structure of RSV pre-F (strain A2) in complex with Fabs 1A2 and 2D10. Determined by electron microscopy at 2.06 Å resolution. Released 22 Jul 2026.

Method: Electron microscopy
Resolution: 2.06 Å
Organisms: Respiratory syncytial virus A2, Enterobacteria phage T6, Homo sapiens
Chains: 15
Atoms: 20,715
Mol. weight: 342.01 kDa
Released: 22 Jul 2026

Explore 9VWE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9VWE contains 75 α-helices and 228 β-strands across 15 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B and C: 15 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	29-33	5	1
β-strand	38-60	23	1
α-helix	74-97	24
α-helix	149-158	10
α-helix	163-170	8
β-strand	176-180	5	1
β-strand	186-194	9	1
α-helix	195-198	4
α-helix	199-203	5
α-helix	204-206	3
β-strand	208	1	2
β-strand	213	1	2
α-helix	217-238	22
β-strand	243-244	2	1
α-helix	247-248	2
α-helix	254-262	9
α-helix	268-275	8
α-helix	278-283	6
β-strand	286-293	8	1
β-strand	296-318	23	1
β-strand	321-322	2	3
β-strand	333-336	4	3
β-strand	340-344	5	1
β-strand	349-352	4	1
α-helix	355-357	3
β-strand	358-360	3	1
β-strand	364-368	5	1
β-strand	373-375	3	1
α-helix	377-383	7
β-strand	395-398	4	3
β-strand	404-407	4	4
β-strand	411-416	6	4
β-strand	422-426	5	5
β-strand	430-434	5	5
β-strand	438-443	6	4
β-strand	449-452	4	5
β-strand	455-458	4	5
β-strand	465-469	5	1
α-helix	474-477	4
β-strand	487	1	3
α-helix	492-505	14

Chains D, F and G: 2 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	6
β-strand	11-12	2	7
β-strand	17-25	9	6
β-strand	33-40	8	8
β-strand	44-51	8	8
β-strand	57-59	3	8
α-helix	64-66	3
β-strand	67-72	6	6
β-strand	77-83	7	6
α-helix	87-89	3
β-strand	91-99	9	8
β-strand	102-106	5	8
β-strand	110-112	3	8
β-strand	113-114	2	7

Chains E, I and J: 2 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	9
β-strand	4	1	10
β-strand	8-11	4	8
β-strand	16-22	7	10
α-helix	24-27	4
β-strand	32-36	5	8
β-strand	43-46	4	8
β-strand	47	1	11
β-strand	51	1	11
β-strand	60-65	6	10
β-strand	68-74	7	10
α-helix	78-80	3
β-strand	83-89	7	8
β-strand	95-97	3	8
β-strand	98	1	9
β-strand	101-105	5	8

Chains H, K and M: 3 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	12
β-strand	10-12	3	13
β-strand	18-25	8	12
α-helix	29-31	3
β-strand	34-39	6	13
β-strand	45-51	7	13
β-strand	58-60	3	13
β-strand	68-72	5	12
β-strand	78-83	6	12
β-strand	92-98	7	13
α-helix	107-109	3
α-helix	110-113	4
β-strand	118	1	13
β-strand	122-126	5	13

Chains L, N and O: 3 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	2-3	2
β-strand	4-6	3	14
β-strand	10-13	4	15
β-strand	19-25	7	14
β-strand	30	1	16
β-strand	36	1	16
β-strand	38-43	6	15
β-strand	50-54	5	15
β-strand	58-59	2	15
α-helix	60	1
β-strand	67-72	6	14
β-strand	75-80	6	14
β-strand	89-95	7	15
β-strand	103-104	2	15
α-helix	105	1
β-strand	108-112	5	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fusion glycoprotein F0,Fibritin	A, B, C	protein	570	Respiratory syncytial virus A2, Enterobacteria phage T6	A0A346FJN8, P03420
2D10 heavy chain	D, F, G	protein	116	Homo sapiens
2D10 light chain	E, I, J	protein	107	Homo sapiens
1A2 heavy chain	H, K, M	protein	128	Homo sapiens
1A2 light chain	L, N, O	protein	113	Homo sapiens

Sequence of entity 1 (A, B, C), FASTA

>9VWE_1 Fusion glycoprotein F0,Fibritin (chains A, B, C)
ATMELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLGALRTGWYTSVIT
IELSNIKEIKCNGTDAKVKLIKQELDKYKNAVTDLQLLMQSTPPTNNRARRELPRFMNYT
LNNAKKTNVTLSKKRKRRFLGFLLGSGSAICSGVAVCKVLHLEGEVNKIKSALLSTNKAV
VSLSNGVSVLTFKVLDLKNYIDKQLLPILNKQSCSIPNIETVIEFQQKNNRLLEITREFS
VNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMCIIKEEVLA
YVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETC
KVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYG
KTKCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYCVNKQEGQSLYVKGEPIINFY
DPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLSAIGGYIPEAPRDGQAYVRKDGEWV
LLSTFLGGLVPRGSHHHHHHSAWSHPQFEK

Sequence of entity 2 (D, F, G), FASTA

>9VWE_2 2D10 heavy chain (chains D, F, G)
QVQLQESGPGLVKPSETLSLTCTVSGGSIGFDYWSWIRQSPEKGLEWIGYVYYSGDTNYN
PSLESRLTISVDTSRSQFSLRLSSVTAADTAVYYCARFGSGGFDSWGQGTLVTVSS

Sequence of entity 3 (E, I, J), FASTA

>9VWE_3 2D10 light chain (chains E, I, J)
SYELKQPPSVSVSPGQTARITCSGDALARHFAHWYQQKPGQAPVLLIYQGTERPSRVPER
FSGSNSGTTVTLTISGVQAEDEADYYCQSADNSGTFVFGTGTKVTVL

Sequence of entity 4 (H, K, M), FASTA

>9VWE_4 1A2 heavy chain (chains H, K, M)
QEQLVESGGGLVKPGGSLRLSCAGSGFTFSDYDISWIRQAPGRGLEWVAYIDSSGTTIYY
ADSVRGRFTISRDTARYSVSLQLSSLRAEDTAVYYCTTKFYDYSSGTIPYYYYGLDVWGQ
GTRVTVSS

Sequence of entity 5 (L, N, O), FASTA

>9VWE_5 1A2 light chain (chains L, N, O)
DIVMTQSPLSLSVTPGQPASISCKSSESLLHTDGKTYLFWYLHKPGQSPQLLIYEVSSRF
SGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHRPPFTFGPGTKVDIR

Primary citation

Cryo-EM structure of RSV pre-F (strain A2) in complex with Fabs 1A2 and 2D10. Liu, L., Sun, P., Li, S. et al. To be published.

Other PDB entries of the same protein (UniProt A0A346FJN8), best resolution first:

8ZQ6 2.77 Å, preF6P of RSV glycoprotein
8ZQ7 2.77 Å, Crystal structure of prefusion RSV F protein
9UE3 2.78 Å, The structure of FIPV spike glycoprotein
8WLU 2.87 Å, Cryo-EM structure of bat RsSHC014 spike glycoprotein
8ZPY 2.92 Å, Crystal structure of prefusion F of RSV
9VWF 3.14 Å, Cryo-EM structure of RSV pre-F (strain A2) in complex with Fab 3G12
8ZHE 3.16 Å, SARS-CoV-2 spike trimer (6P) in complex with three R1-26 Fabs
8ZHM 3.39 Å, SARS-CoV-2 spike trimer (6P) in complex with three H18 and three R1-32 Fabs
8ZHD 3.41 Å, SARS-CoV-2 spike trimer (6P) in complex with two R1-26 Fabs
8ZHG 3.51 Å, SARS-CoV-2 spike trimer (6P) in complex with R1-26 Fab, focused refinement of RBD-Fab…
8WLY 3.96 Å, Cryo-EM structure of bat WIV1 spike glycoprotein
8ZHL 3.96 Å, SARS-CoV-2 spike trimer (6P) in complex with two H18 and two R1-32 Fabs

Browse structure collections

About this viewer

MolViewer shows 9VWE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.