9X8S: Human GAS41 YEATS domain

Crystal structure of the human GAS41 YEATS domain in complex with an acetylated YFV capsid peptide (K4ac). Determined by X-ray diffraction at 1.7 Å resolution. Released 26 Nov 2025.

Method: X-ray diffraction
Resolution: 1.7 Å
Organisms: Homo sapiens, Yellow fever virus
Chains: 6
Atoms: 4,922
Mol. weight: 64.32 kDa
Released: 26 Nov 2025

Explore 9X8S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9X8S contains 16 α-helices and 36 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	20-33	14	1
β-strand	45-53	9	1
α-helix	59-61	3
β-strand	63-69	7	2
α-helix	70-71	2
β-strand	78-81	4	2
β-strand	86-92	7	1
β-strand	95	1	3
β-strand	97-104	8	2
α-helix	105	1
α-helix	111	1
β-strand	112-117	6	2
α-helix	122-123	2
α-helix	124-128	5
β-strand	134-145	12	1

Chain B: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	23-33	11	4
β-strand	45-53	9	4
α-helix	59-61	3
β-strand	63-69	7	5
β-strand	78-81	4	5
β-strand	86-92	7	4
β-strand	97-104	8	5
α-helix	110-111	2
β-strand	112-117	6	5
α-helix	122-123	2
α-helix	124-128	5
β-strand	133-142	10	4

Chain C: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	21-33	13	6
β-strand	45-53	9	6
α-helix	59-61	3
β-strand	63-69	7	7
β-strand	78-81	4	7
β-strand	86-92	7	6
β-strand	97-104	8	7
α-helix	110-111	2
β-strand	112-117	6	7
β-strand	133-144	12	6

Chain D: 4 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	21-33	13	8
β-strand	45-53	9	8
α-helix	59-61	3
β-strand	63-69	7	9
α-helix	70-71	2
β-strand	78-81	4	9
β-strand	86-92	7	8
β-strand	95-96	2	10
β-strand	97-104	8	9
β-strand	112-117	6	9
α-helix	122-123	2
α-helix	125-129	5
β-strand	133-144	12	8

Chain E: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	5	1	3

Chain F: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	4-5	2	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
YEATS domain-containing protein 4	A, B, C, D	protein	133	Homo sapiens	O95619 (AlphaFold model)
Yellow Fever Virus Capsid Protein	E, F	protein	7	Yellow fever virus

Sequence of entity 1 (A, B, C, D), FASTA

>9X8S_1 YEATS domain-containing protein 4 (chains A, B, C, D)
SRVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAYVKKIQFKLHES
YGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKLFQSDTNAMLGKKT
VVSEFYDEMIFQD

Sequence of entity 2 (E, F), FASTA

>9X8S_2 Yellow Fever Virus Capsid Protein (chains E, F)
SGRKAQG

Primary citation

The structure of the human GAS41 YEATS domain in complex with an acetylated YFV capsid peptide (K4ac). Kang, S., Li, X., Chen, S. To be published.

Other PDB entries of the same protein (UniProt O95619 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8IJ0 1.52 Å, Crystal structure of GAS41 YEATS domain in complex with H3K9ac peptide
7EIF 1.58 Å, Crystal structure of GAS41 YEATS domain
5R68 1.64 Å, XChem group deposition -- Crystal Structure of human YEATS4 in complex with FM000199e
5R69 1.83 Å, XChem group deposition -- Crystal Structure of human YEATS4 in complex with XS038644e
5VNA 2.1 Å, Crystal structure of human YEATS domain
8IIZ 2.1 Å, Crystal structure of MBP fused GAS41 YEATS domain in complex with H3K27ac peptide
7JFY 2.1 Å, GAS41 YEATS domain in complex with 5
5XTZ 2.1 Å, Crystal structure of GAS41 YEATS bound to H3K27ac peptide
8IIY 2.15 Å, Crystal structure of MBP fused GAS41 YEATS domain in complex with H3K14ac peptide
8I60 2.3 Å, Crystal structure of GAS41 YEATS domain in complex with histone H3K27cr
9O4Y 2.3 Å, GAS41 YEATS domain in complex with DLG-1
5VNB 2.4 Å, YEATS in complex with histone H3

Browse structure collections

About this viewer

MolViewer shows 9X8S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.