9ZVU: PDB entry 9ZVU

The ubiquitin-associated domain of human thirty-eight negative kinase-1 rigidly fused to a double trigger variant of the 1TEL crystallization chaperone, alternate crystal form. Determined by X-ray diffraction at 1.96 Å resolution. Released 4 Mar 2026.

Method: X-ray diffraction
Resolution: 1.96 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,507
Mol. weight: 40.28 kDa
Ligands: TAR, TLA
Released: 4 Mar 2026

Explore 9ZVU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9ZVU contains 23 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	24-26	3
α-helix	29-42	14
α-helix	45-47	3
α-helix	50-53	4
α-helix	57-61	5
α-helix	65-71	7
α-helix	76-100	25
α-helix	106-115	10
α-helix	120-133	14
α-helix	140-149	10
α-helix	154-163	10

Chain B: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	15-17	3
α-helix	18-21	4
α-helix	24-26	3
α-helix	29-43	15
α-helix	45-47	3
α-helix	57-60	4
α-helix	65-71	7
α-helix	76-100	25
α-helix	106-115	10
α-helix	120-133	14
α-helix	140-149	10
α-helix	154-163	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription factor ETV6,Non-receptor tyrosine-protein kinase TNK1	A, B	protein	165	Homo sapiens	P41212 (AlphaFold model), Q13470 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>9ZVU_1 Transcription factor ETV6,Non-receptor tyrosine-protein kinase TNK1 (chains A, B)
MGHHHHHHHHHHSIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLSPIDSNTFEMNGKAL
LELTKEDFRYRSPHSGDELYELLQHILKEVQRKIMEVELSVHGVTHQEAQTALGATGGDV
VSAIRNLKVDQLFHLSSRSRADAWRILEHYQWDLSAASRYVLARP

Ligands and cofactors

ID	Name	Formula	Copies
TAR	D(-)-tartaric acid	C4 H6 O6	1
TLA	L(+)-tartaric acid	C4 H6 O6	7

Water and common crystallization additives (SO4, NA) are not listed.

Primary citation

Modulating the pH sensitivity of the TELSAM crystallization chaperone for increased solubility. Averett, J.C., Moody, J.D. To be published.

Other PDB entries of the same protein (UniProt P41212 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9DOC 1.19 Å, The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly…
9ZB7 1.24 Å, A DARPin fused to the 1TEL crystallization chaperone via a direct helical fusion
9Q4D 1.3 Å, A DARPin fused to the double trigger 1TEL variant crystallization chaperone via a direct…
7TW9 1.41 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to Sinefungin
1JI7 1.45 Å, Crystal Structure of TEL SAM Polymer
7TDY 1.53 Å, The ubiquitin-associated domain of human thirty-eight negative kinase 1, flexibly fused…
7TW8 1.55 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SAH
8FRJ 1.57 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SGC0946
9DB5 1.57 Å, A DARPin fused to the 1TEL crystallization chaperone via a proline-alanine linker
8FT8 1.6 Å, The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly…
8FRK 1.61 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SGC8158
7TW7 1.62 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SAM

Browse structure collections

About this viewer

MolViewer shows 9ZVU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.