10FJ: FcgRIIa

FcgRIIa in complex with IV.3 Fab. Determined by electron microscopy at 3.5 Å resolution. Released 1 Jul 2026.

Method: Electron microscopy
Resolution: 3.5 Å
Organisms: Homo sapiens, Mus musculus
Chains: 3
Atoms: 4,711
Mol. weight: 71.95 kDa
Released: 1 Jul 2026

Explore 10FJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

10FJ contains 15 α-helices and 59 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	5-8	4
β-strand	25-28	4	1
α-helix	44-46	3
β-strand	56-59	4	1
β-strand	67	1	2
α-helix	78-81	4
β-strand	84	1	2
β-strand	91-94	4	3
α-helix	100-101	2
β-strand	108-112	5	3
β-strand	118	1	4
β-strand	121-125	5	5
β-strand	128-133	6	5
β-strand	138-139	2	3
α-helix	146-148	3
β-strand	150-155	6	5
β-strand	157-158	2	4
β-strand	161-162	2	4
β-strand	168-170	3	5

Chain H: 4 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	22-25	4	6
α-helix	26-28	3
β-strand	29-31	3	7
β-strand	37-38	2	6
β-strand	41-44	4	6
α-helix	48-50	3
β-strand	53-58	6	7
β-strand	65-70	6	7
β-strand	77-78	2	7
β-strand	88-92	5	6
β-strand	97-102	6	6
β-strand	111-114	4	7
β-strand	117	1	7
β-strand	133-137	5	7
α-helix	141	1
β-strand	148	1	8
β-strand	168	1	8
β-strand	179-180	2	9
β-strand	183	1	9
α-helix	199-202	4
β-strand	203	1	10
β-strand	205	1	8
β-strand	221-223	3	9
β-strand	234-236	3	9

Chain L: 6 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	24	1	11
β-strand	29-32	4	12
β-strand	38-42	5	13
β-strand	43	1	11
β-strand	49	1	14
β-strand	55	1	14
β-strand	57-61	5	15
β-strand	62	1	12
β-strand	69-73	5	15
β-strand	77-78	2	15
α-helix	79	1
β-strand	86-90	5	13
β-strand	95-99	5	13
α-helix	104-106	3
β-strand	109-110	2	12
β-strand	112-114	3	15
β-strand	126-130	5	12
β-strand	135	1	16
β-strand	139-142	4	17
α-helix	143-145	3
α-helix	149-151	3
β-strand	153-163	11	17
β-strand	164	1	16
β-strand	169-174	6	18
β-strand	177-178	2	18
β-strand	183-187	5	17
α-helix	188-191	4
β-strand	197-206	10	17
α-helix	207-212	6
β-strand	215-222	8	18
β-strand	226-234	9	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Low affinity immunoglobulin gamma Fc region receptor II-a	A	protein	185	Homo sapiens	P12318 (AlphaFold model)
IV.3 Fab heavy chain	H	protein	238	Mus musculus
IV.3 Fab light chain	L	protein	238	Mus musculus

Sequence of entity 1 (A), FASTA

>10FJ_1 Low affinity immunoglobulin gamma Fc region receptor II-a (chains A)
QAAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFK
ANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVK
VTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSS
SPMGI

Sequence of entity 2 (H), FASTA

>10FJ_2 IV.3 Fab heavy chain (chains H)
MGWSCIILFLVATATGAHSQIQLVQSGPELKKPGETVKISCKASGYTFTNYGMNWVKQAP
GKGLKWMGWLNTYTGESIYPDDFKGRFAFSSETSASTAYLQINNLKNEDMATYFCARGDY
GYDDPLDYWGQGTSVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSW
NSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVV

Sequence of entity 3 (L), FASTA

>10FJ_3 IV.3 Fab light chain (chains L)
MGWSCIILFLVATATGVHSDIVMTQAAPSVPVTPGESVSISCRSSKSLLHTNGNTYLHWF
LQRPGQSPQLLIYRMSVLASGVPDRFSGSGSGTAFTLSISRVEAEDVGVFYCMQHLEYPL
TFGAGTKLELKRTVDAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQS
GNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Primary citation

Mechanistic Basis for the Selective Recognition of the Fc gamma Receptor IIa by Monoclonal Antibody IV.3. Wang, J., Novack, S., Li, J. et al. bioRxiv (2026). DOI 10.64898/2026.03.05.709909 · PubMed

Other PDB entries of the same protein (UniProt P12318 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3RY4 1.5 Å, 1.5 Angstrom resolution structure of glycosylated fcgammariia (low-responder polymorphism)
8CHA 1.81 Å, Fc gamma RIIa 27W/131H variant ectodomain
1FCG 2.0 Å, Ectodomain of human fc gamma receptor, fcgriia
9N5P 2.01 Å, Crystal structure of human IGG2 fc fragment-fc-gamma receptor iia complex H131 variant
3RY5 2.3 Å, Three-dimensional structure of glycosylated fcgammariia (high-responder polymorphism)
9MCX 2.38 Å, Crystal structure of human IgG1 fc fragment-fc-gamma receptor iia complex H131 variant
3D5O 2.8 Å, Structural recognition and functional activation of FcrR by innate pentraxins
1H9V 3.0 Å, Human Fc-gamma-Receptor IIa (FcgRIIa), monoclinic
3RY6 3.8 Å, Complex of fcgammariia (CD32) and the FC of human IGG1

Browse structure collections

About this viewer

MolViewer shows 10FJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.