13FJ: TGFB1

TGFB1 in complex with NIS793 FAB. Determined by X-ray diffraction at 2.75 Å resolution. Released 17 Jun 2026.

Method: X-ray diffraction
Resolution: 2.75 Å
Organism: Homo sapiens
Chains: 6
Atoms: 8,336
Mol. weight: 118.99 kDa
Released: 17 Jun 2026

Explore 13FJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

13FJ contains 33 α-helices and 108 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 3 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	281	1	1
α-helix	282-286	5
β-strand	294-296	3	2
β-strand	299-301	3	3
α-helix	302-306	5
β-strand	311-313	3	1
β-strand	316-318	3	3
β-strand	321-323	3	2
β-strand	332	1	1
α-helix	335-346	12
β-strand	356-370	15	1
β-strand	373-389	17	1

Chain H: 7 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	7
α-helix	7-9	3
β-strand	10-12	3	8
β-strand	18-25	8	7
β-strand	34-39	6	8
β-strand	46-51	6	8
β-strand	58-60	3	8
α-helix	62-64	3
β-strand	68-73	6	7
β-strand	78-83	6	7
α-helix	88-90	3
β-strand	92-99	8	8
β-strand	108-111	4	8
β-strand	115-119	5	8
α-helix	123-124	2
β-strand	125	1	9
β-strand	128-132	5	10
β-strand	143-153	11	10
β-strand	154	1	9
β-strand	159-162	4	11
β-strand	167	1	11
β-strand	171-173	3	10
α-helix	174-176	3
β-strand	177-178	2	10
β-strand	184-193	10	10
α-helix	194-197	4
β-strand	203-208	6	11
α-helix	209-211	3
β-strand	213-218	6	11

Chain I: 6 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	12
α-helix	7-9	3
β-strand	10-12	3	13
β-strand	18-25	8	12
β-strand	34-39	6	13
β-strand	46-51	6	13
β-strand	58-60	3	13
α-helix	62-64	3
β-strand	68-73	6	12
β-strand	78-83	6	12
α-helix	88-90	3
β-strand	92-99	8	13
β-strand	108-111	4	13
β-strand	115-119	5	13
β-strand	125	1	14
β-strand	128-132	5	15
β-strand	143-153	11	15
β-strand	154	1	14
β-strand	159-162	4	16
β-strand	167	1	16
β-strand	171-173	3	15
α-helix	174-176	3
β-strand	177-178	2	15
β-strand	184-193	10	15
α-helix	194-197	4
β-strand	203-208	6	16
α-helix	209-211	3
β-strand	213-218	6	16

Chain L: 8 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	17
β-strand	9-12	4	18
β-strand	18-23	6	17
α-helix	27-29	3
β-strand	33-37	5	18
β-strand	44-47	4	18
β-strand	48	1	19
β-strand	52	1	19
β-strand	61-66	6	17
β-strand	69-74	6	17
α-helix	79-81	3
β-strand	84-91	8	18
β-strand	96-99	4	18
β-strand	103-107	5	18
α-helix	110-112	3
β-strand	113	1	20
β-strand	116-120	5	21
α-helix	121-123	3
α-helix	124-128	5
β-strand	132-141	10	21
β-strand	142	1	20
β-strand	146-152	7	22
β-strand	155-156	2	22
α-helix	157	1
β-strand	161-163	3	21
α-helix	164-166	3
β-strand	167	1	23
β-strand	174	1	21
β-strand	175	1	23
β-strand	176-182	7	21
α-helix	184-188	5
β-strand	193-199	7	22
β-strand	202-208	7	22

Chain M: 6 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	24
β-strand	9-12	4	25
β-strand	18-23	6	24
α-helix	27-29	3
β-strand	33-37	5	25
β-strand	44-47	4	25
β-strand	48	1	26
β-strand	52	1	26
β-strand	61-66	6	24
β-strand	69-74	6	24
α-helix	79-81	3
β-strand	83-91	9	25
β-strand	96-99	4	25
β-strand	103-107	5	25
β-strand	116-120	5	27
α-helix	121-123	3
α-helix	124-128	5
β-strand	132-141	10	27
β-strand	146-152	7	28
β-strand	155-157	3	28
β-strand	161-163	3	27
α-helix	164-166	3
β-strand	167-168	2	27
β-strand	174-182	9	27
α-helix	184-188	5
β-strand	193-199	7	28
β-strand	202-208	7	28

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transforming growth factor beta-1	A, B	protein	112	Homo sapiens	P01137 (AlphaFold model)
NIS793 Fab heavy chain	H, I	protein	224	Homo sapiens
NIS793 Fab light chain	L, M	protein	214	Homo sapiens

Sequence of entity 1 (A, B), FASTA

>13FJ_1 Transforming growth factor beta-1 (chains A, B)
ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSK
VLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Sequence of entity 2 (H, I), FASTA

>13FJ_2 NIS793 Fab heavy chain (chains H, I)
QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPIFGTANY
AQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARGLWEVRALPSVYWGQGTLVTVS
SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSC

Sequence of entity 3 (L, M), FASTA

>13FJ_3 NIS793 Fab light chain (chains L, M)
SYELTQPPSVSVAPGQTARITCGANDIGSKSVHWYQQKAGQAPVLVVSEDIIRPSGIPER
ISGSNSGNTATLTISRVEAGDEADYYCQVWDRDSDQYVFGTGTKVTVLGQPKAAPSVTLF
PPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYL
SLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Primary citation

Biomarker Analysis from Patients with Metastatic PDAC Treated with TGF beta Antibody NIS793 plus Abraxane + Gemcitabine versus Abraxane + Gemcitabine Alone in a Phase II, Open-Label, Randomized Study. Pelletier, M., Yang, J., Joshi, M. et al. Clin Cancer Res (2026) 32:4001-4015. DOI 10.1158/1078-0432.CCR-26-0805 · PubMed

Other PDB entries of the same protein (UniProt P01137 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8UDZ 2.21 Å, The Structure of LTBP-49247 Fab Bound to TGFbeta1 Small Latent Complex
9VJJ 2.48 Å, Crystal Structure of human Latent TGF-beta1 in complex with SOF10
8C7H 2.7 Å, Cryo-EM Map of the latTGF-beta LHG-10 Fab complex
6OM2 2.77 Å, Crystal structure of atypical integrin alphaV beta8 with proTGF-beta1 ligand peptide
5VQP 2.9 Å, Crystal structure of human pro-TGF-beta1
8REW 2.98 Å, CryoEM structure of human GARP-lTGFbeta1 in complex with a Fab fragment derived from an…
3KFD 3.0 Å, Ternary complex of TGF-b1 reveals isoform-specific ligand recognition and receptor…
4KV5 3.0 Å, scFv GC1009 in complex with TGF-beta1.
8VSC 3.0 Å, L-tgf-b1/GARP
9R3S 3.06 Å, pro-TGF-beta1 in complex with the third TB Domain from Latent Transforming Growth…
6GFF 3.1 Å, Structure of GARP (LRRC32) in complex with latent TGF-beta1 and MHG-8 Fab
8VSD 3.2 Å, avb8/L-TGF-b1/GARP

Browse structure collections

About this viewer

MolViewer shows 13FJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.