8C7H: Transforming growth factor beta-1

Cryo-EM Map of the latTGF-beta LHG-10 Fab complex. Determined by electron microscopy at 2.7 Å resolution. Released 1 Mar 2023.

Method: Electron microscopy
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 7
Atoms: 9,172
Mol. weight: 197.42 kDa
Released: 1 Mar 2023

Explore 8C7H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8C7H contains 24 α-helices and 95 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
β-strand	31-32	2	1
α-helix	39-49	11
β-strand	107	1	2

Chain B: 1 helix, 8 β-strands

Element	Residues	Length	Sheet
β-strand	280-281	2	3
α-helix	282-285	4
β-strand	294-296	3	4
β-strand	299-301	3	5
β-strand	311-313	3	3
β-strand	316-318	3	5
β-strand	321-323	3	4
β-strand	356-370	15	3
β-strand	373-389	17	3

Chain C: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	38-56	19
α-helix	62-64	3
α-helix	68-69	2
α-helix	75-84	10
α-helix	100-103	4
β-strand	106-112	7	3
α-helix	137-143	7
β-strand	150-159	10	3
β-strand	162	1	6
β-strand	166-173	8	7
β-strand	179-187	9	7
α-helix	188-189	2
β-strand	190	1	6
β-strand	194-199	6	3
α-helix	201-206	6
β-strand	257-262	6	3

Chain D: 3 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	282-286	5
β-strand	294-296	3	8
α-helix	297	1
β-strand	300-301	2	9
β-strand	311-313	3	2
β-strand	316-317	2	9
β-strand	321-323	3	8
α-helix	341-346	6
β-strand	356-358	3	10
β-strand	361-370	10	2
β-strand	373-384	12	2
β-strand	387-389	3	10

Chain I: 8 helices, 32 β-strands

Element	Residues	Length	Sheet
β-strand	34	1	11
β-strand	53-55	3	11
β-strand	63-64	2	12
α-helix	66-69	4
β-strand	77-79	3	11
β-strand	87-88	2	12
β-strand	101-103	3	11
α-helix	112-115	4
β-strand	128-130	3	11
α-helix	140-144	5
α-helix	145-147	3
β-strand	153-155	3	11
β-strand	163-164	2	13
β-strand	177-179	3	11
β-strand	187-188	2	13
β-strand	201-203	3	11
β-strand	211-214	4	1
β-strand	222-224	3	11
β-strand	232-233	2	1
β-strand	247-249	3	11
β-strand	269-271	3	11
β-strand	292	1	14
β-strand	297	1	14
β-strand	319-321	3	11
α-helix	332-337	6
β-strand	343-345	3	11
β-strand	353-356	4	15
β-strand	367-369	3	11
β-strand	377-380	4	15
β-strand	390-392	3	11
β-strand	414-416	3	11
β-strand	447-449	3	11
β-strand	457-458	2	16
α-helix	460-462	3
β-strand	470-472	3	11
β-strand	480-481	2	16
α-helix	482	1
β-strand	495-497	3	11
α-helix	510-512	3
β-strand	518-520	3	11

Chain K: 2 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	24-26	3	23
β-strand	30-33	4	19
β-strand	39-45	7	23
β-strand	53-58	6	19
β-strand	66-70	5	19
β-strand	73-74	2	19
β-strand	82-87	6	23
β-strand	90-95	6	23
α-helix	100-102	3
β-strand	104-110	7	19
β-strand	117-118	2	19
β-strand	122-126	5	19
β-strand	136-138	3	24
β-strand	153-159	7	24
β-strand	165-167	3	25
α-helix	185-187	3
β-strand	193-197	5	24
β-strand	215-217	3	25
β-strand	226	1	25

Chain L: 1 helix, 19 β-strands

Element	Residues	Length	Sheet
β-strand	17-19	3	17
β-strand	32-35	4	18
β-strand	37-39	3	17
α-helix	43-45	3
β-strand	48-53	6	19
β-strand	60-65	6	19
β-strand	72-73	2	19
β-strand	82-83	2	18
β-strand	86-87	2	20
β-strand	92-93	2	20
β-strand	94-97	4	18
β-strand	106-112	7	19
β-strand	129-130	2	19
β-strand	135-136	2	19
β-strand	147-151	5	21
β-strand	164-169	6	21
β-strand	177	1	22
β-strand	189-191	3	21
β-strand	202-207	6	21
β-strand	224	1	22

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transforming growth factor beta-1	A, C	protein	249	Homo sapiens	P01137 (AlphaFold model)
Transforming growth factor beta-1	B, D	protein	112	Homo sapiens	P01137 (AlphaFold model)
Transforming growth factor beta activator LRRC32	I	protein	601	Homo sapiens	Q14392 (AlphaFold model)
28G11 Fab heavy chain	L	protein	227	Homo sapiens
28G11 Fab light chain	K	protein	214	Homo sapiens

Sequence of entity 1 (A, C), FASTA

>8C7H_1 Transforming growth factor beta-1 (chains A, C)
LSTCKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPLPEAVLALYNSTRDRVA
GESAEPEPEPEADYYAKEVTRVLMVETHNEIYDKFKQSTHSIYMFFNTSELREAVPEPVL
LSRAELRLLRLKLKVEQHVELYQKYSNNSWRYLSNRLLAPSDSPEWLSFDVTGVVRQWLS
RGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATIHGMNRPFLLLMATPLERAQ
HLQSSRHRR

Sequence of entity 2 (B, D), FASTA

>8C7H_2 Transforming growth factor beta-1 (chains B, D)
ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSK
VLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Sequence of entity 3 (I), FASTA

>8C7H_3 Transforming growth factor beta activator LRRC32 (chains I)
HQDKVPCKMVDKKVSCQVLGLLQVPSVLPPDTETLDLSGNQLRSILASPLGFYTALRHLD
LSTNEISFLQPGAFQALTHLEHLSLAHNRLAMATALSAGGLGPLPRVTSLDLSGNSLYSG
LLERLLGEAPSLHTLSLAENSLTRLTRHTFRDMPALEQLDLHSNVLMDIEDGAFEGLPRL
THLNLSRNSLTCISDFSLQQLRVLDLSCNSIEAFQTASQPQAEFQLTWLDLRENKLLHFP
DLAALPRLIYLNLSNNLIRLPTGPPQDSKGIHAPSEGWSALPLSAPSGNASGRPLSQLLN
LDLSYNEIELIPDSFLEHLTSLCFLNLSRNCLRTFEARRLGSLPCLMLLDLSHNALETLE
LGARALGSLRTLLLQGNALRDLPPYTFANLASLQRLNLQGNRVSPCGGPDEPGPSGCVAF
SGITSLRSLSLVDNEIELLRAGAFLHTPLTELDLSSNPGLEVATGALGGLEASLEVLALQ
GNGLMVLQVDLPCFICLKRLNLAENRLSHLPAWTQAVSLEVLDLRNNSFSLLPGSAMGGL
ETSLRRLYLQGNPLSCCGNGWLAAQLHQGRVDVDATQDLICRFSSQEEVSLSHVRPEDCE
K

Sequence of entity 4 (L), FASTA

>8C7H_4 28G11 Fab heavy chain (chains L)
EVQLVQPGAELRNSGASVKVSCKASGYRFTSYYIDWVRQAPGQGLEWMGRIDPEDGGTKY
AQKFQGRVTFTADTSTSTAYVELSSLRSEDTAVYYCARNEWETVVVGDLMYEYEYWGQGT
QVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFP
AVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK

Sequence of entity 5 (K), FASTA

>8C7H_5 28G11 Fab light chain (chains K)
DIQMTQSPSSLSASLGDRVTITCQASQSISSYLAWYQQKPGQAPNILIYGASRLKTGVPS
RFSGSGSGTSFTLTISGLEAEDAGTYYCQQYASVPVTFGQGTKVELKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Primary citation

Anti-GARP Antibodies Inhibit Release of TGF-beta by Regulatory T Cells via Different Modes of Action, but Do Not Influence Their Function In Vitro. Igney, F.H., Ebenhoch, R., Schiele, F. et al. Immunohorizons (2023) 7:200-212. DOI 10.4049/immunohorizons.2200072 · PubMed

Other PDB entries of the same protein (UniProt P01137 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8UDZ 2.21 Å, The Structure of LTBP-49247 Fab Bound to TGFbeta1 Small Latent Complex
9VJJ 2.48 Å, Crystal Structure of human Latent TGF-beta1 in complex with SOF10
13FJ 2.75 Å, TGFB1 in complex with NIS793 FAB
6OM2 2.77 Å, Crystal structure of atypical integrin alphaV beta8 with proTGF-beta1 ligand peptide
5VQP 2.9 Å, Crystal structure of human pro-TGF-beta1
8REW 2.98 Å, CryoEM structure of human GARP-lTGFbeta1 in complex with a Fab fragment derived from an…
3KFD 3.0 Å, Ternary complex of TGF-b1 reveals isoform-specific ligand recognition and receptor…
4KV5 3.0 Å, scFv GC1009 in complex with TGF-beta1.
8VSC 3.0 Å, L-tgf-b1/GARP
9R3S 3.06 Å, pro-TGF-beta1 in complex with the third TB Domain from Latent Transforming Growth…
6GFF 3.1 Å, Structure of GARP (LRRC32) in complex with latent TGF-beta1 and MHG-8 Fab
8VSD 3.2 Å, avb8/L-TGF-b1/GARP

Browse structure collections

About this viewer

MolViewer shows 8C7H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.