5VQP: Human pro-TGF-beta1

Crystal structure of human pro-TGF-beta1. Determined by X-ray diffraction at 2.9 Å resolution. Released 15 Nov 2017.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,615
Mol. weight: 42.08 kDa
Released: 15 Nov 2017

Explore 5VQP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5VQP contains 9 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	4-28	25
α-helix	43-45	3
α-helix	46-56	11
β-strand	78-83	6	1
α-helix	84-86	3
β-strand	101-107	7	2
α-helix	108-114	7
α-helix	118-120	3
β-strand	121-130	10	1
β-strand	137-145	9	2
β-strand	149-158	10	2
β-strand	165-170	6	1
α-helix	172-180	9
β-strand	185-192	8	2
β-strand	193-199	7	3
β-strand	202-208	7	3
β-strand	219	1	1
β-strand	228-233	6	1
α-helix	236-239	4
α-helix	256-259	4
β-strand	265-272	8	4
β-strand	282-284	3	5
β-strand	287-294	8	4
β-strand	327-341	15	5
β-strand	344-360	17	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transforming growth factor beta-1	A	protein	363	Homo sapiens	P01137 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5VQP_1 Transforming growth factor beta-1 (chains A)
GPLSTSKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPLPEAVLALYNSTRDR
VAGESAEPEPEPEADYYAKEVTRVLMVETHNEIYDKFKQSTHSIYMFFQTSELREAVPEP
VLLSRAELRLLRLKLKVEQHVELYQKYSQNSWRYLSNRLLAPSDSPEWLSFDVTGVVRQW
LSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATIHGMNRPFLLLMATPLER
AQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCP
YIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSC
KCS

Primary citation

Prodomain-growth factor swapping in the structure of pro-TGF-beta 1. Zhao, B., Xu, S., Dong, X. et al. J Biol Chem (2018) 293:1579-1589. DOI 10.1074/jbc.M117.809657 · PubMed

Other PDB entries of the same protein (UniProt P01137 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8UDZ 2.21 Å, The Structure of LTBP-49247 Fab Bound to TGFbeta1 Small Latent Complex
9VJJ 2.48 Å, Crystal Structure of human Latent TGF-beta1 in complex with SOF10
8C7H 2.7 Å, Cryo-EM Map of the latTGF-beta LHG-10 Fab complex
13FJ 2.75 Å, TGFB1 in complex with NIS793 FAB
6OM2 2.77 Å, Crystal structure of atypical integrin alphaV beta8 with proTGF-beta1 ligand peptide
8REW 2.98 Å, CryoEM structure of human GARP-lTGFbeta1 in complex with a Fab fragment derived from an…
3KFD 3.0 Å, Ternary complex of TGF-b1 reveals isoform-specific ligand recognition and receptor…
4KV5 3.0 Å, scFv GC1009 in complex with TGF-beta1.
8VSC 3.0 Å, L-tgf-b1/GARP
9R3S 3.06 Å, pro-TGF-beta1 in complex with the third TB Domain from Latent Transforming Growth…
6GFF 3.1 Å, Structure of GARP (LRRC32) in complex with latent TGF-beta1 and MHG-8 Fab
8VSD 3.2 Å, avb8/L-TGF-b1/GARP

Browse structure collections

About this viewer

MolViewer shows 5VQP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.