1A7C: Human plasminogen activator inhibitor type-1

Human plasminogen activator inhibitor type-1 in complex with a pentapeptide. Determined by X-ray diffraction at 1.95 Å resolution. Released 23 Mar 1999.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Homo sapiens
Chains: 3
Atoms: 3,098
Mol. weight: 44.63 kDa
Ligands: NAG
Released: 23 Mar 1999

Explore 1A7C in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1A7C contains 16 α-helices and 19 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	4-26	23
β-strand	32-34	3	1
α-helix	36-49	14
α-helix	52-62	11
α-helix	71-83	13
α-helix	85-87	3
β-strand	90-100	11	2
α-helix	105-106	2
α-helix	109-117	9
α-helix	120-121	2
β-strand	122-124	3	2
α-helix	129-143	15
β-strand	161-172	12	2
β-strand	175	1	3
α-helix	178-180	3
α-helix	181-183	3
β-strand	185-190	6	1
β-strand	196-214	19	1
β-strand	220-227	8	1
β-strand	228	1	3
β-strand	233-240	8	1
α-helix	248-251	4
α-helix	256-264	9
β-strand	267-276	10	1
β-strand	278-285	8	2
α-helix	287-292	6
α-helix	297-299	3
β-strand	316-319	4	2
β-strand	321-328	8	2
α-helix	349	1
β-strand	350-353	4	1
β-strand	358-364	7	1
β-strand	369-376	8	1

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	902-904	3	2

Chain C: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	912-914	3	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Plasminogen activator inhibitor type 1	A	protein	379	Homo sapiens	P05121 (AlphaFold model)
Pentapeptide	B, C	protein	7

Sequence of entity 1 (A), FASTA

>1A7C_1 PLASMINOGEN ACTIVATOR INHIBITOR TYPE 1 (chains A)
VHHPPSYVAHLASDFGVRVFQQVAQASKDRNVVFSPYGVASVLAMLQLTTGGETQQQIQA
AMGFKIDDKGMAPALRHLYKELMGPWNKDEISTTDAIFVQRDLKLVQGFMPHFFRLFRST
VKQVDFSEVERARFIINDWVKTHTKGMISNLLGKGAVDQLTRLVLVNALYFNGQWKTPFP
DSSTHRRLFHKSDGSTVSVPMMAQTNKFNYTEFTTPDGHYYDILELPYHGDTLSMFIAAP
YEKEVPLSALTNILSAQLISHWKGNMTRLPRLLVLPKFSLETEVDLRKPLENLGMTDMFR
QFQADFTSLSDQEPLHVAQALQKVKIEVNESGTVESSSTAVIVSARMAPEEIIMDRPFLF
VVRHNPTGTVLFMGQVMEP

Sequence of entity 2 (B, C), FASTA

>1A7C_2 PENTAPEPTIDE (chains B, C)
XTVASSX

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1

Primary citation

Interfering with the inhibitory mechanism of serpins: crystal structure of a complex formed between cleaved plasminogen activator inhibitor type 1 and a reactive-centre loop peptide. Xue, Y., Bjorquist, P., Inghardt, T. et al. Structure (1998) 6:627-636. DOI 10.1016/S0969-2126(98)00064-1 · PubMed

Other PDB entries of the same protein (UniProt P05121 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7AQF 1.77 Å, Crystal Structure of Small Molecule Inhibitor TM5484 Bound to Stabilized Active…
1LJ5 1.8 Å, 1.8A Resolution Structure of Latent Plasminogen Activator Inhibitor-1(PAI-1)
6ZRV 1.88 Å, Crystal Structure of Stabilized Active Plasminogen Activator Inhibitor-1 (PAI-1-W175F)…
3CVM 2.02 Å, High resolution structure of a stable Plasminogen activator inhibitor type-1 in its…
6GWN 2.03 Å, Crystal Structure of Stabilized Active Plasminogen Activator Inhibitor-1 (PAI-1-W175F)…
1DVN 2.1 Å, Latent form of plasminogen activator inhibitor-1 (pai-1)
4G8R 2.19 Å, Crystal Structure of a novel small molecule inactivator bound to plasminogen activator…
7AQG 2.27 Å, Crystal Structure of Small Molecule Inhibitor TM5484 Bound to Stabilized Active…
1OC0 2.28 Å, plasminogen activator inhibitor-1 complex with somatomedin B domain of vitronectin
6GWP 2.28 Å, Crystal Structure of Stabilized Active Plasminogen Activator Inhibitor-1 (PAI-1-stab) in…
3PB1 2.3 Å, Crystal Structure of a Michaelis Complex between Plasminogen Activator Inhibitor-1 and…
3Q02 2.3 Å, Crystal structure of plasminogen activator inhibitor-1 in a metastable active…

Browse structure collections

About this viewer

MolViewer shows 1A7C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.