Crystal structure of plasminogen activator inhibitor-1 in a metastable active conformation. Determined by X-ray diffraction at 2.3 Å resolution. Released 22 Jun 2011.
Explore 3Q02 in 3D Show helices and sheets RCSB PDB PDBe
3Q02 contains 27 α-helices and 32 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 7-24 | 18 | |
| β-strand | 32-34 | 3 | 1 |
| α-helix | 36-49 | 14 | |
| α-helix | 52-62 | 11 | |
| α-helix | 71-82 | 12 | |
| α-helix | 85-87 | 3 | |
| β-strand | 91-100 | 10 | 2 |
| α-helix | 104-106 | 3 | |
| α-helix | 109-117 | 9 | |
| β-strand | 122-124 | 3 | 2 |
| α-helix | 129-142 | 14 | |
| β-strand | 163-171 | 9 | 2 |
| β-strand | 175 | 1 | 3 |
| α-helix | 178-180 | 3 | |
| α-helix | 181-183 | 3 | |
| β-strand | 185-190 | 6 | 1 |
| β-strand | 196-214 | 19 | 1 |
| β-strand | 220-227 | 8 | 1 |
| β-strand | 228 | 1 | 3 |
| β-strand | 233-240 | 8 | 1 |
| α-helix | 248-251 | 4 | |
| α-helix | 256-265 | 10 | |
| β-strand | 267-276 | 10 | 1 |
| β-strand | 278-285 | 8 | 2 |
| α-helix | 287-292 | 6 | |
| α-helix | 297-299 | 3 | |
| β-strand | 319-328 | 10 | 2 |
| β-strand | 350-353 | 4 | 1 |
| β-strand | 358-364 | 7 | 1 |
| β-strand | 369-376 | 8 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-26 | 23 | |
| β-strand | 32-34 | 3 | 4 |
| α-helix | 36-46 | 11 | |
| α-helix | 52-62 | 11 | |
| α-helix | 71-82 | 12 | |
| β-strand | 91-100 | 10 | 5 |
| α-helix | 104-106 | 3 | |
| α-helix | 109-117 | 9 | |
| β-strand | 122-124 | 3 | 5 |
| α-helix | 129-142 | 14 | |
| β-strand | 163-171 | 9 | 5 |
| β-strand | 175 | 1 | 6 |
| α-helix | 178-180 | 3 | |
| α-helix | 181-183 | 3 | |
| β-strand | 185-190 | 6 | 4 |
| β-strand | 196-214 | 19 | 4 |
| β-strand | 220-227 | 8 | 4 |
| β-strand | 228 | 1 | 6 |
| β-strand | 233-240 | 8 | 4 |
| α-helix | 248-251 | 4 | |
| α-helix | 256-264 | 9 | |
| β-strand | 267-276 | 10 | 4 |
| β-strand | 278-285 | 8 | 5 |
| α-helix | 287-292 | 6 | |
| α-helix | 297-299 | 3 | |
| β-strand | 319-328 | 10 | 5 |
| β-strand | 350-353 | 4 | 4 |
| β-strand | 358-364 | 7 | 4 |
| β-strand | 369-376 | 8 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Plasminogen activator inhibitor 1 | A, B | protein | 379 | Homo sapiens | P05121 (AlphaFold model) |
>3Q02_1 Plasminogen activator inhibitor 1 (chains A, B) VHHPPSYVAHLASDFGVRVFQQVAQASKDRNVVFSPYGVASVLAMLQLTTGGETQQQIQA AMGFKIDDKGMAPALRHLYKELMGPWNKDEISTTDAIFVQRDLKLVQGFMPHFFRLFRST VKQVDFSEVERARFIINDWVKTHTKGMISNLLGKGAVDQLTRLVLVNALYFNGQFKTPFP DSSTHRRLFHKSDGSTVSVPMMAQTNKFNYTEFTTPDGHYYDILELPYHGDTLSMFIAAP YEKEVPLSALTNILSAQLISHWKGNMTRLPRLLVLPKFSLETEVDLRKPLENLGMTDMFR QFQADFTSLSDQEPLHVAQALQKVKIEVNESGTVASSSTAVIVSARMAPEEIIMDRPFLF VVRHNPTGTVLFMGQVMEP
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 2 |
Water and common crystallization additives (EDO, CL) are not listed.
Crystal structure of plasminogen activator inhibitor-1 in an active conformation with normal thermodynamic stability. Jensen, J.K., Thompson, L.C., Bucci, J.C. et al. J Biol Chem (2011) 286:29709-29717. DOI 10.1074/jbc.M111.236554 · PubMed
Other PDB entries of the same protein (UniProt P05121 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3Q02 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.