High resolution structure of a stable Plasminogen activator inhibitor type-1 in its protease cleaved form. Determined by X-ray diffraction at 2.02 Å resolution. Released 19 Aug 2008.
Explore 3CVM in 3D Show helices and sheets RCSB PDB PDBe
3CVM contains 27 α-helices and 38 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1-2 | 2 | 1 |
| α-helix | 3-25 | 23 | |
| β-strand | 32-34 | 3 | 2 |
| α-helix | 36-49 | 14 | |
| α-helix | 52-62 | 11 | |
| α-helix | 71-83 | 13 | |
| α-helix | 85-87 | 3 | |
| β-strand | 90-100 | 11 | 3 |
| α-helix | 105-106 | 2 | |
| α-helix | 109-117 | 9 | |
| β-strand | 120-124 | 5 | 3 |
| α-helix | 129-143 | 15 | |
| β-strand | 161-174 | 14 | 3 |
| β-strand | 175 | 1 | 4 |
| α-helix | 178-180 | 3 | |
| α-helix | 181-183 | 3 | |
| β-strand | 185-190 | 6 | 2 |
| β-strand | 196-214 | 19 | 2 |
| β-strand | 220-227 | 8 | 2 |
| β-strand | 228 | 1 | 4 |
| β-strand | 233-240 | 8 | 2 |
| α-helix | 248-251 | 4 | |
| α-helix | 256-264 | 9 | |
| β-strand | 267-276 | 10 | 2 |
| β-strand | 278-285 | 8 | 3 |
| α-helix | 287-292 | 6 | |
| α-helix | 297-299 | 3 | |
| β-strand | 315-328 | 14 | 3 |
| β-strand | 332-345 | 14 | 3 |
| β-strand | 351-353 | 3 | 2 |
| β-strand | 358-364 | 7 | 2 |
| β-strand | 369-376 | 8 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1-2 | 2 | 2 |
| α-helix | 3-25 | 23 | |
| β-strand | 32-34 | 3 | 1 |
| α-helix | 36-49 | 14 | |
| α-helix | 52-62 | 11 | |
| α-helix | 71-83 | 13 | |
| α-helix | 85-87 | 3 | |
| β-strand | 90-100 | 11 | 5 |
| β-strand | 105 | 1 | 6 |
| α-helix | 109-117 | 9 | |
| β-strand | 120-124 | 5 | 5 |
| α-helix | 129-143 | 15 | |
| β-strand | 161-174 | 14 | 5 |
| β-strand | 175 | 1 | 7 |
| α-helix | 178-180 | 3 | |
| α-helix | 181-183 | 3 | |
| β-strand | 185-190 | 6 | 1 |
| β-strand | 196-214 | 19 | 1 |
| β-strand | 220-227 | 8 | 1 |
| β-strand | 228 | 1 | 7 |
| β-strand | 233-240 | 8 | 1 |
| α-helix | 248-251 | 4 | |
| α-helix | 256-265 | 10 | |
| β-strand | 267-276 | 10 | 1 |
| β-strand | 278-285 | 8 | 5 |
| α-helix | 287-292 | 6 | |
| α-helix | 297-299 | 3 | |
| β-strand | 310 | 1 | 6 |
| β-strand | 316-328 | 13 | 5 |
| β-strand | 332-344 | 13 | 5 |
| β-strand | 351-353 | 3 | 1 |
| β-strand | 358-364 | 7 | 1 |
| β-strand | 369-376 | 8 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Plasminogen activator inhibitor 1 | A, B | protein | 392 | Homo sapiens | P05121 (AlphaFold model) |
>3CVM_1 Plasminogen activator inhibitor 1 (chains A, B) MRGSHHHHHHGSAVHHPPSYVARLASDFGVRVFQQVAQASKDRNVVFSPYGVASVLAMLQ LTTGGETQQQIQAAMGFKIDDKGMAPALRHLYKELMGPWNKDEISTTDAIFVQRDLKLVQ GFMPHFFRLFRSTVKQVDFSEVERARFIINDWVKTHTKGMISHLLGTGAVDQLTRLVLVN ALYFNGQWKTPFPDSSTHRRLFHKSDGSTVSVPMMAQTNKFNYTEFTTPDGHYYDILELP YHGDTLSMFIAAPYEKEVPLSALTNILSAQLISHWKGNMTRLPRLLVLPKFSLETEVDLR KPLENLGMTDMFRQFQADFTSLSDQEPLHVALALQKVKIEVNESGTVASSSTAVIVSARM APEEIIIDRPFLFVVRHNPTGTVLFMGQVMEP
High-resolution structure of the stable plasminogen activator inhibitor type-1 variant 14-1B in its proteinase-cleaved form: a new tool for detailed interaction studies and modeling. Jensen, J.K., Gettins, P.G. Protein Sci (2008) 17:1844-1849. DOI 10.1110/ps.036707.108 · PubMed
Other PDB entries of the same protein (UniProt P05121 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3CVM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.