1ABT: Alpha-bungarotoxin

Name: PDB 1ABT: NMR solution structure of an alpha-bungarotoxin(slash)nicotinic receptor peptide complex
Published: 1994-01-31
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: toxin

NMR solution structure of an alpha-bungarotoxin(slash)nicotinic receptor peptide complex. Determined by solution NMR. Released 31 Jan 1994.

Method: Solution NMR
Chains: 2
Atoms: 614
Mol. weight: 9.52 kDa
Released: 31 Jan 1994

Explore 1ABT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1ABT contains 1 α-helix and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 10 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	1
β-strand	12-15	4	1
β-strand	22	1	2
β-strand	23	1	3
β-strand	26-27	2	4
α-helix	31-33	3
β-strand	40-41	2	4
β-strand	45	1	2
β-strand	56-57	2	4
β-strand	60	1	3
β-strand	64	1	1

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	78-79	2	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha-bungarotoxin	A	protein	74		P60615 (AlphaFold model)
Nicotinic receptor peptide	B	protein	12		P02710 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1ABT_1 ALPHA-BUNGAROTOXIN (chains A)
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCC
STDKCNPHPKQRPG

Sequence of entity 2 (B), FASTA

>1ABT_2 NICOTINIC RECEPTOR PEPTIDE (chains B)
KHWVYYTCCPDT

Primary citation

NMR solution structure of an alpha-bungarotoxin/nicotinic receptor peptide complex. Basus, V.J., Song, G., Hawrot, E. Biochemistry (1993) 32:12290-12298. DOI 10.1021/bi00097a004 · PubMed

Other PDB entries of the same protein (UniProt P60615 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9FYS 1.32 Å, D11 mAbs bound to alpha-Bungarotoxin
9HUB 1.33 Å, D11 mAbs bound to alpha-Bungarotoxin at pH 7.5
1HC9 1.8 Å, alpha-bungarotoxin complexed with high affinity peptide
8VY8 2.4 Å, Recombinant alpha bungarotoxin complexed with HAP peptide
9GU1 2.48 Å, Human adult muscle nAChR in resting state in nanodisc with alpha-bungarotoxin
2ABX 2.5 Å, The crystal structure of alpha-bungarotoxin at 2.5 Å resolution. Relation to solution…
8DA1 2.67 Å, Crystal structure of Krait alpha-neurotoxin in complex with Centi-LNX-D09 antibody
6UWZ 2.69 Å, Cryo-EM structure of Torpedo acetylcholine receptor in complex with alpha-bungarotoxin
9GU0 2.96 Å, Human adult muscle nAChR in resting state in detergent with alpha-bungarotoxin
1BXP Solution NMR structure of the complex of alpha-bungarotoxin with a library derived…
1HAA A beta-Hairpin Structure in a 13-mer Peptide that Binds a-Bungarotoxin with High…
1HAJ A beta-Hairpin Structure in a 13-mer Peptide that Binds a-Bungarotoxin with High…

Browse structure collections

About this viewer

MolViewer shows 1ABT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.