1AUI: Human calcineurin heterodimer

Human calcineurin heterodimer. Determined by X-ray diffraction at 2.1 Å resolution. Released 3 Dec 1997.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,832
Mol. weight: 78.23 kDa
Ligands: CA, FE, ZN
Released: 3 Dec 1997

Explore 1AUI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1AUI contains 32 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	29	1	1
α-helix	31-34	4
β-strand	35	1	2
β-strand	41	1	2
α-helix	43-51	9
β-strand	56	1	1
α-helix	58-73	16
β-strand	78-81	4	3
α-helix	82	1
β-strand	85-88	4	4
α-helix	95-105	11
β-strand	113-115	3	4
α-helix	126-139	14
β-strand	144-146	3	4
α-helix	154-159	6
α-helix	162-169	8
α-helix	172-182	11
β-strand	188-191	4	3
β-strand	195-198	4	3
α-helix	209-214	6
α-helix	221-222	2
α-helix	226-232	7
β-strand	234-235	2	5
β-strand	248-250	3	5
β-strand	258-260	3	5
α-helix	262-271	10
β-strand	276-279	4	3
β-strand	288-290	3	3
α-helix	292	1
β-strand	293	1	6
α-helix	294	1
β-strand	300	1	6
β-strand	302-305	4	3
α-helix	311-313	3
β-strand	319-325	7	4
β-strand	328-334	7	4
α-helix	344-346	3
α-helix	349-369	21
α-helix	470-477	8
α-helix	478-481	4

Chain B: 12 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	16-29	14
β-strand	36-37	2	7
α-helix	39-42	4
α-helix	46-49	4
α-helix	54-61	8
β-strand	69-70	2	7
α-helix	71-78	8
α-helix	79-81	3
α-helix	87-98	12
β-strand	105-106	2	8
α-helix	108-119	12
α-helix	125-139	15
β-strand	147-148	2	8
α-helix	149-156	8
α-helix	157-159	3
α-helix	161-164	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine phosphatase 2B	A	protein	521	Homo sapiens	Q08209 (AlphaFold model)
Serine/threonine phosphatase 2B	B	protein	169	Homo sapiens	P63098 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1AUI_1 SERINE/THREONINE PHOSPHATASE 2B (chains A)
MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESV
ALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYV
DRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMD
AFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFG
NEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFP
SLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEK
VTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESV
LTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRIN
ERMPPRRDAMPSDANLNSINKALTSETNGTDSNGSNSSNIQ

Sequence of entity 2 (B), FASTA

>1AUI_2 SERINE/THREONINE PHOSPHATASE 2B (chains B)
GNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDI
FDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVG
NNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	4
FE	FE (III) ion	Fe	1
ZN	Zinc ion	Zn	1

Primary citation

Crystal structures of human calcineurin and the human FKBP12-FK506-calcineurin complex. Kissinger, C.R., Parge, H.E., Knighton, D.R. et al. Nature (1995) 378:641-644. DOI 10.1038/378641a0 · PubMed

Other PDB entries of the same protein (UniProt Q08209 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2W73 1.45 Å, High-resolution structure of the complex between calmodulin and a peptide from…
4F0Z 1.7 Å, Crystal Structure of Calcineurin in Complex with the Calcineurin-Inhibiting Domain of…
6UUQ 1.85 Å, Structure of Calcineurin bound to RCAN1
2R28 1.86 Å, The complex Structure of Calmodulin Bound to a Calcineurin Peptide
6NUC 1.9 Å, Structure of Calcineurin in complex with NHE1 peptide
6NUF 1.9 Å, Structure of Calcineurin in complex with NHE1 peptide
4Q5U 1.95 Å, Structure of calmodulin bound to its recognition site from calcineurin
3LL8 2.0 Å, Crystal Structure of Calcineurin in Complex with AKAP79 Peptide
9NXE 2.09 Å, Crystal Structure of Calcineurin Clinical Variant E282K
9NXN 2.1 Å, Crystal structure of CN:RII alpha
2P6B 2.3 Å, Crystal Structure of Human Calcineurin in Complex with PVIVIT Peptide
6NUU 2.3 Å, Structure of Calcineurin mutant in complex with NHE1 peptide

Browse structure collections

About this viewer

MolViewer shows 1AUI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.