1AW6: GAL4 (CD), NMR, 24 structures

GAL4 (CD), NMR, 24 structures. Determined by solution NMR. Released 15 Apr 1998.

Method: Solution NMR
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 349
Mol. weight: 5.28 kDa
Ligands: CD
Released: 15 Apr 1998

Explore 1AW6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1AW6 contains 2 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	12-17	6
α-helix	29-34	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
GAL4 (CD)	A	protein	43	Saccharomyces cerevisiae	P04386 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1AW6_1 GAL4 (CD) (chains A)
MKLLSSIEQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPK

Ligands and cofactors

ID	Name	Formula	Copies
CD	Cadmium ion	Cd	2

Primary citation

Refined solution structure of the DNA-binding domain of GAL4 and use of 3J(113Cd,1H) in structure determination. Baleja, J.D., Thanabal, V., Wagner, G. J Biomol NMR (1997) 10:397-401. DOI 10.1023/A:1018332327565 · PubMed

Other PDB entries of the same protein (UniProt P04386 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3COQ 2.4 Å, Structural Basis for Dimerization in DNA Recognition by Gal4
1D66 2.7 Å, DNA recognition by GAL4: structure of a protein/dna complex
3BTS 2.7 Å, Crystal structure of a ternary complex of the transcriptional repressor Gal80p (Gal80S0…
7UIO 3.3 Å, Mediator-PIC Early (Composite Model)
7UIK 7.7 Å, Mediator-PIC Early (Tail A + Upstream DNA & Activator)
1HBW Solution nmr structure of the dimerization domain of the yeast transcriptional activator…

Browse structure collections

About this viewer

MolViewer shows 1AW6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.