Mac-1 I domain magnesium complex. Determined by X-ray diffraction at 2.7 Å resolution. Released 4 Nov 1998.
Explore 1BHO in 3D Show helices and sheets RCSB PDB PDBe
1BHO contains 25 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 134-140 | 7 | 1 |
| α-helix | 147-163 | 17 | |
| β-strand | 170-176 | 7 | 1 |
| β-strand | 180-184 | 5 | 1 |
| α-helix | 186-189 | 4 | |
| α-helix | 195-199 | 5 | |
| α-helix | 211-217 | 7 | |
| α-helix | 218-222 | 5 | |
| α-helix | 225-227 | 3 | |
| β-strand | 235-241 | 7 | 1 |
| α-helix | 252-254 | 3 | |
| α-helix | 256-261 | 6 | |
| β-strand | 264-271 | 8 | 1 |
| α-helix | 281-287 | 7 | |
| α-helix | 289 | 1 | |
| α-helix | 292-295 | 4 | |
| β-strand | 296-299 | 4 | 1 |
| α-helix | 305-307 | 3 | |
| α-helix | 309-315 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 434-440 | 7 | 2 |
| β-strand | 442 | 1 | 3 |
| α-helix | 449-463 | 15 | |
| β-strand | 470-476 | 7 | 2 |
| β-strand | 480-484 | 5 | 2 |
| α-helix | 486-489 | 4 | |
| α-helix | 495-499 | 5 | |
| β-strand | 506 | 1 | 3 |
| α-helix | 511-517 | 7 | |
| α-helix | 518-522 | 5 | |
| α-helix | 525-527 | 3 | |
| β-strand | 535-541 | 7 | 2 |
| α-helix | 552-561 | 10 | |
| β-strand | 564-571 | 8 | 2 |
| α-helix | 573-575 | 3 | |
| α-helix | 580-587 | 8 | |
| α-helix | 592-594 | 3 | |
| β-strand | 596-599 | 4 | 2 |
| α-helix | 603-608 | 6 | |
| α-helix | 609-615 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| CD11B | 1, 2 | protein | 190 | Homo sapiens | P11215 (AlphaFold model) |
>1BHO_1 CD11B (chains 1, 2) XSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKTLFSLMQYSEEFRIHFTFKEFQN NPNPRSLVKPITQLLGRTHTATGIRKVVRELFNITNGARKNAFKILVVITDGEKFGDPLG YEDVIPEADREGVIRYVIGVGDAFRSEKSRQELNTIASKPPRDHVFQVNNFEALKTIQNQ LREKIFAIEG
| ID | Name | Formula | Copies |
|---|---|---|---|
| MG | Magnesium ion | Mg | 2 |
Cation binding to the integrin CD11b I domain and activation model assessment. Baldwin, E.T., Sarver, R.W., Bryant Jr., G.L. et al. Structure (1998) 6:923-935. DOI 10.1016/S0969-2126(98)00093-8 · PubMed
Other PDB entries of the same protein (UniProt P11215 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1BHO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.