1BMG: Bovine BETA2-microglobulin

Crystal structure of bovine BETA2-microglobulin. Determined by X-ray diffraction at 2.5 Å resolution. Released 15 Oct 1995.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Bos taurus
Chains: 1
Atoms: 848
Mol. weight: 11.65 kDa
Released: 15 Oct 1995

Explore 1BMG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1BMG contains 1 α-helix and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	1
α-helix	4-5	2
β-strand	6-11	6	2
β-strand	21-30	10	2
β-strand	31	1	1
β-strand	36-41	6	3
β-strand	44-45	2	3
β-strand	49-50	2	2
β-strand	54-56	3	2
β-strand	60-69	10	2
β-strand	77-82	6	3
β-strand	90-93	4	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
BETA=2=-microglobulin	A	protein	98	Bos taurus	P01888 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1BMG_1 BETA=2=-MICROGLOBULIN (chains A)
IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWS
FYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Primary citation

Three-dimensional structure of beta 2-microglobulin. Becker, J.W., Reeke Jr., G.N. Proc Natl Acad Sci U S A (1985) 82:4225-4229. DOI 10.1073/pnas.82.12.4225 · PubMed

Other PDB entries of the same protein (UniProt P01888 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2XFX 1.9 Å, cattle MHC class I N01301 presenting an 11mer from Theileria parva
3L9R 2.3 Å, Crystal structure of bovine CD1b3 with endogenously bound ligands
4F7E 2.4 Å, Crystal structure of bovine CD1d with bound C16:0-alpha-galactosyl ceramide
3PWV 2.7 Å, An immmunodominant CTL epitope from rinderpest virus presented by cattle MHC class I…
4IIQ 2.86 Å, Crystal structure of a human MAIT TCR in complex with bovine MR1
4F7C 2.86 Å, Crystal structure of bovine CD1d with bound C12-di-sulfatide
4L8S 2.9 Å, Crystal structure of a human Valpha7.2/Vbeta13.3 MAIT TCR in complex with bovine MR1
4LCC 3.26 Å, Crystal structure of a human MAIT TCR in complex with a bacterial antigen bound to…
4L9L 3.4 Å, Crystal structure of a human Valpha7.2/Vbeta13.2 MAIT TCR in complex with bovine MR1
7RNO Model of the Ac-6-FP/hpMR1/bB2m/TAPBPR complex from integrated docking, NMR and…

Browse structure collections

About this viewer

MolViewer shows 1BMG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.