Crystal structure of the MT1-mmp--timp-2 complex. Determined by X-ray diffraction at 2.75 Å resolution. Released 18 Aug 1999.
Explore 1BQQ in 3D Show helices and sheets RCSB PDB PDBe
1BQQ contains 12 α-helices and 27 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 123-125 | 3 | 1 |
| β-strand | 127-128 | 2 | 2 |
| α-helix | 137-154 | 18 | |
| β-strand | 158-160 | 3 | 1 |
| β-strand | 178-182 | 5 | 2 |
| β-strand | 198-202 | 5 | 2 |
| α-helix | 203-204 | 2 | |
| β-strand | 213-216 | 4 | 2 |
| β-strand | 222 | 1 | 3 |
| β-strand | 232 | 1 | 3 |
| α-helix | 233-243 | 11 | |
| β-strand | 260 | 1 | 2 |
| α-helix | 273-276 | 4 | |
| α-helix | 279 | 1 | |
| α-helix | 280-285 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1002-1003 | 2 | 2 |
| α-helix | 1008-1014 | 7 | |
| β-strand | 1017-1022 | 6 | 4 |
| β-strand | 1023 | 1 | 5 |
| β-strand | 1029-1030 | 2 | 6 |
| β-strand | 1042-1045 | 4 | 6 |
| β-strand | 1047 | 1 | 5 |
| β-strand | 1051-1054 | 4 | 4 |
| β-strand | 1063-1065 | 3 | 6 |
| β-strand | 1083-1088 | 6 | 4 |
| β-strand | 1089-1090 | 2 | 6 |
| β-strand | 1096-1097 | 2 | 6 |
| β-strand | 1104-1106 | 3 | 4 |
| α-helix | 1107-1109 | 3 | |
| α-helix | 1112-1115 | 4 | |
| α-helix | 1121-1124 | 4 | |
| α-helix | 1125-1127 | 3 | |
| β-strand | 1129 | 1 | 7 |
| β-strand | 1132 | 1 | 8 |
| β-strand | 1145 | 1 | 7 |
| β-strand | 1148 | 1 | 8 |
| α-helix | 1160-1163 | 4 | |
| β-strand | 1166-1169 | 4 | 9 |
| β-strand | 1175-1178 | 4 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Membrane-type matrix metalloproteinase | M | protein | 174 | Homo sapiens | P50281 (AlphaFold model) |
| Metalloproteinase inhibitor 2 | T | protein | 184 | Bos taurus | P16368 (AlphaFold model) |
>1BQQ_1 MEMBRANE-TYPE MATRIX METALLOPROTEINASE (chains M) IQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEK QADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDI FLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGES
>1BQQ_2 METALLOPROTEINASE INHIBITOR 2 (chains T) CSCSPVHPQQAFCNADIVIRAKAVNKKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPDQDI EFIYTAPAAAVCGVSLDIGGKKEYLIAGKAEGNGNMHITLCDFIVPWDTLSATQKKSLNH RYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRG AAPP
Crystal structure of the complex formed by the membrane type 1-matrix metalloproteinase with the tissue inhibitor of metalloproteinases-2, the soluble progelatinase A receptor. Fernandez-Catalan, C., Bode, W., Huber, R. et al. EMBO J (1998) 17:5238-5248. DOI 10.1093/emboj/17.17.5238 · PubMed
Other PDB entries of the same protein (UniProt P50281 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1BQQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.