1BXP: Alpha-bungarotoxin

Solution NMR structure of the complex of alpha-bungarotoxin with a library derived peptide, 20 structures. Determined by solution NMR. Released 27 Jan 1999.

Method: Solution NMR
Organism: Bungarus multicinctus
Chains: 2
Atoms: 666
Mol. weight: 9.65 kDa
Released: 27 Jan 1999

Explore 1BXP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1BXP contains 0 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	2-4	3	1
β-strand	13-15	3	1
β-strand	22-26	5	2
β-strand	41-45	5	2
β-strand	60	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha-bungarotoxin	A	protein	74	Bungarus multicinctus	P60615 (AlphaFold model)
Peptide met-arg-tyr-tyr-glu-ser-ser-leu-lys-ser-tyr-pro-asp	B	protein	13

Sequence of entity 1 (A), FASTA

>1BXP_1 ALPHA-BUNGAROTOXIN (chains A)
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCC
STDKCNPHPKQRPG

Sequence of entity 2 (B), FASTA

>1BXP_2 PEPTIDE MET-ARG-TYR-TYR-GLU-SER-SER-LEU-LYS-SER-TYR-PRO-ASP (chains B)
MRYYESSLKSYPD

Primary citation

Three-dimensional solution structure of the complex of alpha-bungarotoxin with a library-derived peptide. Scherf, T., Balass, M., Fuchs, S. et al. Proc Natl Acad Sci U S A (1997) 94:6059-6064. DOI 10.1073/pnas.94.12.6059 · PubMed

Other PDB entries of the same protein (UniProt P60615 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9FYS 1.32 Å, D11 mAbs bound to alpha-Bungarotoxin
9HUB 1.33 Å, D11 mAbs bound to alpha-Bungarotoxin at pH 7.5
1HC9 1.8 Å, alpha-bungarotoxin complexed with high affinity peptide
8VY8 2.4 Å, Recombinant alpha bungarotoxin complexed with HAP peptide
9GU1 2.48 Å, Human adult muscle nAChR in resting state in nanodisc with alpha-bungarotoxin
2ABX 2.5 Å, The crystal structure of alpha-bungarotoxin at 2.5 Å resolution. Relation to solution…
8DA1 2.67 Å, Crystal structure of Krait alpha-neurotoxin in complex with Centi-LNX-D09 antibody
6UWZ 2.69 Å, Cryo-EM structure of Torpedo acetylcholine receptor in complex with alpha-bungarotoxin
9GU0 2.96 Å, Human adult muscle nAChR in resting state in detergent with alpha-bungarotoxin
1ABT NMR solution structure of an alpha-bungarotoxin(slash)nicotinic receptor peptide complex
1HAA A beta-Hairpin Structure in a 13-mer Peptide that Binds a-Bungarotoxin with High…
1HAJ A beta-Hairpin Structure in a 13-mer Peptide that Binds a-Bungarotoxin with High…

Browse structure collections

About this viewer

MolViewer shows 1BXP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.