1C15: Apaf-1 card

Solution structure of apaf-1 card. Determined by solution NMR. Released 20 Sept 1999.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 775
Mol. weight: 11.1 kDa
Released: 20 Sept 1999

Explore 1C15 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1C15 contains 8 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	3-11	9
α-helix	13-19	7
α-helix	24-29	6
α-helix	30-34	5
α-helix	38-45	8
α-helix	51-63	13
α-helix	66-76	11
α-helix	81-88	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Apoptotic protease activating factor 1	A	protein	97	Homo sapiens	O14727 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1C15_1 APOPTOTIC PROTEASE ACTIVATING FACTOR 1 (chains A)
MDAKARNCLLQHREALEKDIKTSYIMDHMISDGFLTISEEEKVRNEPTQQQRAAMLIKMI
LKKDNDSYVSFYNALLHEGYKDLAALLHDGIPVVSSS

Primary citation

Solution structure of Apaf-1 CARD and its interaction with caspase-9 CARD: a structural basis for specific adaptor/caspase interaction. Zhou, P., Chou, J., Olea, R.S. et al. Proc Natl Acad Sci U S A (1999) 96:11265-11270. DOI 10.1073/pnas.96.20.11265 · PubMed

Other PDB entries of the same protein (UniProt O14727 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1CY5 1.3 Å, Crystal structure of the apaf-1 card
2P1H 1.59 Å, Rapid Folding and Unfolding of Apaf-1 CARD
2YGS 1.6 Å, Card domain from apaf-1
4RHW 2.1 Å, Crystal structure of Apaf-1 CARD and caspase-9 CARD complex
1Z6T 2.21 Å, Structure of the apoptotic protease-activating factor 1 bound to ADP
3YGS 2.5 Å, Apaf-1 card in complex with prodomain of procaspase-9
8XQK 2.85 Å, The Crystal Structure of Apaf from Biortus.
5WVC 2.99 Å, Structure of the CARD-CARD disk
3JBT 3.8 Å, Atomic structure of the Apaf-1 apoptosome
5JUY 4.1 Å, Active human apoptosome with procaspase-9
5WVE 4.4 Å, Apaf-1-Caspase-9 holoenzyme
3J2T 9.5 Å, An improved model of the human apoptosome

Browse structure collections

About this viewer

MolViewer shows 1C15 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.