8XQK: Apaf from Biortus

The Crystal Structure of Apaf from Biortus. Determined by X-ray diffraction at 2.85 Å resolution. Released 6 Mar 2024.

Method: X-ray diffraction
Resolution: 2.85 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,222
Mol. weight: 45.1 kDa
Ligands: PO4
Released: 6 Mar 2024

Explore 8XQK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8XQK contains 28 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	3-19	17
α-helix	22-32	11
α-helix	37-44	8
α-helix	49-60	12
α-helix	65-77	13
α-helix	81-88	8

Chain B: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	3-11	9
α-helix	13-19	7
α-helix	24-32	9
α-helix	37-44	8
α-helix	49-60	12
α-helix	65-77	13
α-helix	81-88	8

Chain C: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	3-11	9
α-helix	13-19	7
α-helix	22-32	11
α-helix	37-44	8
α-helix	49-60	12
α-helix	65-77	13
α-helix	81-88	8

Chain D: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	3-11	9
α-helix	13-19	7
α-helix	22-32	11
α-helix	37-44	8
α-helix	49-60	12
α-helix	65-77	13
α-helix	81-86	6
α-helix	88-90	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Apoptotic protease-activating factor 1	A, B, C, D	protein	98	Homo sapiens	O14727 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>8XQK_1 Apoptotic protease-activating factor 1 (chains A, B, C, D)
GMDAKARNCLLQHREALEKDIKTSYIMDHMISDGFLTISEEEKVRNEPTQQQRAAMLIKM
ILKKDNDSYVSFYNALLHEGYKDLAALLHDGIPVVSSS

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	5

Primary citation

The Crystal Structure of Apaf from Biortus. Wang, F., Cheng, W., Lv, Z. et al. To be published.

Other PDB entries of the same protein (UniProt O14727 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1CY5 1.3 Å, Crystal structure of the apaf-1 card
2P1H 1.59 Å, Rapid Folding and Unfolding of Apaf-1 CARD
2YGS 1.6 Å, Card domain from apaf-1
4RHW 2.1 Å, Crystal structure of Apaf-1 CARD and caspase-9 CARD complex
1Z6T 2.21 Å, Structure of the apoptotic protease-activating factor 1 bound to ADP
3YGS 2.5 Å, Apaf-1 card in complex with prodomain of procaspase-9
5WVC 2.99 Å, Structure of the CARD-CARD disk
3JBT 3.8 Å, Atomic structure of the Apaf-1 apoptosome
5JUY 4.1 Å, Active human apoptosome with procaspase-9
5WVE 4.4 Å, Apaf-1-Caspase-9 holoenzyme
3J2T 9.5 Å, An improved model of the human apoptosome
1C15 Solution structure of apaf-1 card

Browse structure collections

About this viewer

MolViewer shows 8XQK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.