2P1H: Rapid Folding and Unfolding of Apaf-1 CARD

Rapid Folding and Unfolding of Apaf-1 CARD. Determined by X-ray diffraction at 1.59 Å resolution. Released 15 May 2007.

Method: X-ray diffraction
Resolution: 1.59 Å
Organism: Homo sapiens
Chains: 1
Atoms: 811
Mol. weight: 11.18 kDa
Ligands: ZN
Released: 15 May 2007

Explore 2P1H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2P1H contains 8 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	5-13	9
α-helix	15-21	7
α-helix	24-34	11
α-helix	39-46	8
α-helix	51-62	12
α-helix	67-79	13
α-helix	83-89	7
α-helix	90-92	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Apoptotic protease-activating factor 1	A	protein	94	Homo sapiens	O14727 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2P1H_1 Apoptotic protease-activating factor 1 (chains A)
GSMDAKARNCLLQHREALEKDIKTSYIMDHMISDGFLTISEEEKVRNEPTQQQRAAMLIK
MILKKDNDSYVSFYNALLHEGYKDLAALLHDGIP

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	6

Primary citation

Rapid Folding and Unfolding of Apaf-1 CARD. Milam, S.L., Nicely, N.I., Feeney, B. et al. J Mol Biol (2007) 369:290-304. DOI 10.1016/j.jmb.2007.02.105 · PubMed

Other PDB entries of the same protein (UniProt O14727 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1CY5 1.3 Å, Crystal structure of the apaf-1 card
2YGS 1.6 Å, Card domain from apaf-1
4RHW 2.1 Å, Crystal structure of Apaf-1 CARD and caspase-9 CARD complex
1Z6T 2.21 Å, Structure of the apoptotic protease-activating factor 1 bound to ADP
3YGS 2.5 Å, Apaf-1 card in complex with prodomain of procaspase-9
8XQK 2.85 Å, The Crystal Structure of Apaf from Biortus.
5WVC 2.99 Å, Structure of the CARD-CARD disk
3JBT 3.8 Å, Atomic structure of the Apaf-1 apoptosome
5JUY 4.1 Å, Active human apoptosome with procaspase-9
5WVE 4.4 Å, Apaf-1-Caspase-9 holoenzyme
3J2T 9.5 Å, An improved model of the human apoptosome
1C15 Solution structure of apaf-1 card

Browse structure collections

About this viewer

MolViewer shows 2P1H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.