2YGS: Card domain from apaf-1

Card domain from apaf-1. Determined by X-ray diffraction at 1.6 Å resolution. Released 19 Apr 2000.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Homo sapiens
Chains: 1
Atoms: 879
Mol. weight: 10.64 kDa
Released: 19 Apr 2000

Explore 2YGS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2YGS contains 6 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	3-19	17
α-helix	23-32	10
α-helix	37-44	8
α-helix	49-60	12
α-helix	65-77	13
α-helix	81-88	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Apoptotic protease activating factor 1	A	protein	92	Homo sapiens	O14727 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2YGS_1 APOPTOTIC PROTEASE ACTIVATING FACTOR 1 (chains A)
MDAKARNCLLQHREALEKDIKTSYIMDHMISDGFLTISEEEKVRNEPTQQQRAAMLIKMI
LKKDNDSYVSFYNALLHEGYKDLAALLHDGIP

Primary citation

Structural basis of procaspase-9 recruitment by the apoptotic protease-activating factor 1. Qin, H., Srinivasula, S.M., Wu, G. et al. Nature (1999) 399:549-557. DOI 10.1038/21124 · PubMed

Other PDB entries of the same protein (UniProt O14727 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1CY5 1.3 Å, Crystal structure of the apaf-1 card
2P1H 1.59 Å, Rapid Folding and Unfolding of Apaf-1 CARD
4RHW 2.1 Å, Crystal structure of Apaf-1 CARD and caspase-9 CARD complex
1Z6T 2.21 Å, Structure of the apoptotic protease-activating factor 1 bound to ADP
3YGS 2.5 Å, Apaf-1 card in complex with prodomain of procaspase-9
8XQK 2.85 Å, The Crystal Structure of Apaf from Biortus.
5WVC 2.99 Å, Structure of the CARD-CARD disk
3JBT 3.8 Å, Atomic structure of the Apaf-1 apoptosome
5JUY 4.1 Å, Active human apoptosome with procaspase-9
5WVE 4.4 Å, Apaf-1-Caspase-9 holoenzyme
3J2T 9.5 Å, An improved model of the human apoptosome
1C15 Solution structure of apaf-1 card

Browse structure collections

About this viewer

MolViewer shows 2YGS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.