1C7U: Myocyte-specific enhancer factor 2A, C4 form

Complex of the DNA binding core domain of the transcription factor MEF2A with a 20mer oligonucleotide. Determined by solution NMR. Released 27 Mar 2000.

Method: Solution NMR
Organism: Homo sapiens
Chains: 4
Atoms: 2,038
Mol. weight: 32.28 kDa
Released: 27 Mar 2000

Explore 1C7U in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1C7U contains 4 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	13-38	26
β-strand	42-48	7	1
β-strand	52-56	5	1
α-helix	61-71	11

Chain B: 2 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	113-138	26
β-strand	141-148	8	1
β-strand	152-156	5	1
α-helix	161-171	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
5'-d(cptpcpgpgpcptpaptptpapaptpapgpcpcpgpapg)-3'	C, D	DNA	20
Myocyte-specific enhancer factor 2A, C4 form	A, B	protein	85	Homo sapiens	Q02078 (AlphaFold model)

Sequence of entity 1 (C, D), FASTA

>1C7U_1 5'-D(*CP*TP*CP*GP*GP*CP*TP*AP*TP*TP*AP*AP*TP*AP*GP*CP*CP*GP*AP*G)-3' (chains C, D)
CTCGGCTATTAATAGCCGAG

Sequence of entity 2 (A, B), FASTA

>1C7U_2 MYOCYTE-SPECIFIC ENHANCER FACTOR 2A, C4 FORM (chains A, B)
GRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLADAEIALIIFNSSNKLFQYASTD
MDKVLLKYTEYNEPHESRTNSDIVE

Primary citation

Solution structure of the MEF2A-DNA complex: structural basis for the modulation of DNA bending and specificity by MADS-box transcription factors. Huang, K., Louis, J.M., Donaldson, L. et al. EMBO J (2000) 19:2615-2628. DOI 10.1093/emboj/19.11.2615 · PubMed

Other PDB entries of the same protein (UniProt Q02078 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1EGW 1.5 Å, Crystal structure of MEF2A core bound to DNA
6WC2 2.1 Å, Crystal Structure of a Ternary MEF2 Chimera/NKX2-5/myocardin enhancer DNA Complex
3P57 2.19 Å, Crystal structure of the p300 TAZ2 domain bound to MEF2 on DNA
1LEW 2.3 Å, Crystal structure of map kinase P38 complexed to the docking site on its nuclear…
6BYY 2.3 Å, MEF2 CHIMERA/DNA Complex
3MU6 2.43 Å, Inhibiting the Binding of Class IIa Histone Deacetylases to Myocyte Enhancer Factor-2 by…
3KOV 2.9 Å, Structure of MEF2A bound to DNA reveals a completely folded MADS-box/MEF2 domain that…
6BZ1 2.97 Å, MEF2 Chimera D83V mutant/DNA complex
7XUZ 3.59 Å, Crystal structure of a HDAC4-MEF2A-DNA ternary complex

Browse structure collections

About this viewer

MolViewer shows 1C7U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.