1CQT: Pou domain, class 2, transcription factor 1

Crystal structure of a ternary complex containing an oca-B peptide, the oct-1 pou domain, and an octamer element. Determined by X-ray diffraction at 3.2 Å resolution. Released 15 Nov 1999.

Method: X-ray diffraction
Resolution: 3.2 Å
Organism: Homo sapiens
Chains: 8
Atoms: 3,649
Mol. weight: 65.62 kDa
Released: 15 Nov 1999

Explore 1CQT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1CQT contains 19 α-helices and 2 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	6-22	17
α-helix	27-33	7
α-helix	35-38	4
α-helix	44-51	8
α-helix	57-61	5
α-helix	64-72	9
α-helix	110-120	11
α-helix	128-138	11
α-helix	142-159	18

Chain B: 8 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	508-522	15
α-helix	529-533	5
α-helix	544-552	9
β-strand	556	1	1
α-helix	557-573	17
α-helix	607-609	3
α-helix	610-620	11
α-helix	635-638	4
α-helix	643-659	17

Chain I: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	312-318	7

Chain J: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	811	1	1
α-helix	812-818	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA (5'-d(tpgptpaptpgpcpapapaptpapapgp*g)-3')	M, O	DNA	15
DNA (5'-d(apcpcptptpaptptptpgpcpaptpap*c)-3')	N, P	DNA	15
Pou domain, class 2, transcription factor 1	A, B	protein	163	Homo sapiens	P14859 (AlphaFold model)
Pou domain, class 2, associating factor 1	I, J	protein	44	Homo sapiens	Q16633 (AlphaFold model)

Sequence of entity 1 (M, O), FASTA

>1CQT_1 DNA (5'-D(*TP*GP*TP*AP*TP*GP*CP*AP*AP*AP*TP*AP*AP*GP*G)-3') (chains M, O)
TGTATGCAAATAAGG

Sequence of entity 2 (N, P), FASTA

>1CQT_2 DNA (5'-D(*AP*CP*CP*TP*TP*AP*TP*TP*TP*GP*CP*AP*TP*AP*C)-3') (chains N, P)
ACCTTATTTGCATAC

Sequence of entity 3 (A, B), FASTA

>1CQT_3 POU DOMAIN, CLASS 2, TRANSCRIPTION FACTOR 1 (chains A, B)
GSREEPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSF
KNMCKLKPLLEKWLNDAENLSSDSSLSSPSALNSPGIEGLSRRRKKRTSIETNIRVALEK
SFLENQKPTSEEITMIADQLNMEKEVIRVWFCNRRQKEKRINP

Sequence of entity 4 (I, J), FASTA

>1CQT_4 POU DOMAIN, CLASS 2, ASSOCIATING FACTOR 1 (chains I, J)
MLWQKPTAPEQAPAPARPYQGVRVKEPVKELLRRKRGHASSGAA

Primary citation

Crystal structure of an OCA-B peptide bound to an Oct-1 POU domain/octamer DNA complex: specific recognition of a protein-DNA interface. Chasman, D., Cepek, K., Sharp, P.A. et al. Genes Dev (1999) 13:2650-2657. DOI 10.1101/gad.13.20.2650 · PubMed

Other PDB entries of the same protein (UniProt P14859 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1E3O 1.9 Å, Crystal structure of Oct-1 POU dimer bound to MORE
1GT0 2.6 Å, Crystal structure of a POU/HMG/DNA ternary complex
1HF0 2.7 Å, Crystal structure of the DNA-binding domain of Oct-1 bound to DNA as a dimer
1OCT 3.0 Å, Crystal structure of the oct-1 pou domain bound to an octamer site: DNA recognition with…
1O4X Ternary complex of the DNA binding domains of the OCT1 and SOX2 transcription factors…
1POG Solution structure of the oct-1 pou-homeo domain determined by NMR and restrained…
1POU The solution structure of the oct-1 pou-specific domain reveals a striking similarity to…

Browse structure collections

About this viewer

MolViewer shows 1CQT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.