1CQU: N-terminal domain of ribosomal protein L9

Solution structure of the N-terminal domain of ribosomal protein L9. Determined by solution NMR. Released 27 Apr 2002.

Method: Solution NMR
Organism: Geobacillus stearothermophilus
Chains: 1
Atoms: 438
Mol. weight: 6.23 kDa
Released: 27 Apr 2002

Explore 1CQU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1CQU contains 3 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	1
β-strand	17-20	4	1
α-helix	25	1
α-helix	26-34	9
β-strand	36-38	3	1
α-helix	41-49	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
50S ribosomal protein L9	A	protein	56	Geobacillus stearothermophilus	P02417 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1CQU_1 50S RIBOSOMAL PROTEIN L9 (chains A)
MKVIFLKDVKGKGKKGEIKNVADGYANNFLFKQGLAIEATPANLKALEAQKQKEQR

Primary citation

Effects of varying the local propensity to form secondary structure on the stability and folding kinetics of a rapid folding mixed alpha/beta protein: characterization of a truncation mutant of the N-terminal domain of the ribosomal protein L9. Luisi, D.L., Kuhlman, B., Sideras, K. et al. J Mol Biol (1999) 289:167-174. DOI 10.1006/jmbi.1999.2742 · PubMed

Other PDB entries of the same protein (UniProt P02417 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2HBA 1.25 Å, Crystal Structure of N-terminal Domain of Ribosomal Protein L9 (NTL9) K12M
2HVF 1.57 Å, Crystal Structure of N-terminal Domain of Ribosomal Protein L9 (NTL9), G34dA
2HBB 1.9 Å, Crystal Structure of the N-terminal Domain of Ribosomal Protein L9 (NTL9)
1DIV 2.6 Å, Ribosomal protein L9
4V42 5.5 Å, Crystal structure of the ribosome at 5.5 A resolution.
4V4R 5.9 Å, Crystal structure of the whole ribosomal complex.
4V4T 6.46 Å, Crystal structure of the whole ribosomal complex with a stop codon in the A-site.
4V4S 6.76 Å, Crystal structure of the whole ribosomal complex.
487D 7.5 Å, Seven ribosomal proteins fitted to a CRYO-electron microscopic map of the large 50S…

Browse structure collections

About this viewer

MolViewer shows 1CQU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.