1CRC: Cytochrome C at low ionic strength

Cytochrome C at low ionic strength. Determined by X-ray diffraction at 2.08 Å resolution. Released 8 Mar 1996.

Method: X-ray diffraction
Resolution: 2.08 Å
Organism: Equus caballus
Chains: 2
Atoms: 1,934
Mol. weight: 24.74 kDa
Ligands: HEC
Released: 8 Mar 1996

Explore 1CRC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1CRC contains 12 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	3-13	11
α-helix	24-26	3
α-helix	30-31	2
β-strand	36	1	1
β-strand	38	1	1
β-strand	39	1	2
α-helix	50-54	5
β-strand	58	1	2
α-helix	61-69	9
α-helix	71-74	4
α-helix	88-101	14

Chain B: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	5-11	7
α-helix	38	1
β-strand	39	1	3
β-strand	58	1	3
α-helix	61-69	9
α-helix	71-74	4
α-helix	88-101	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cytochrome C	A, B	protein	105	Equus caballus	P00004 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1CRC_1 CYTOCHROME C (chains A, B)
XGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFTYTDANKNKGITW
KEETLMEYLENPKKYIPGTKMIFAGIKKKTEREDLIAYLKKATNE

Ligands and cofactors

ID	Name	Formula	Copies
HEC	Heme C	C34 H36 Fe N4 O4	2

Primary citation

The low ionic strength crystal structure of horse cytochrome c at 2.1 A resolution and comparison with its high ionic strength counterpart. Sanishvili, R., Volz, K.W., Westbrook, E.M. et al. Structure (1995) 3:707-716. DOI 10.1016/S0969-2126(01)00205-2 · PubMed

Other PDB entries of the same protein (UniProt P00004 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6K9J 0.98 Å, 0.98 A three-dimensional structure of horse heart cytochrome C at 110K
8ZXR 1.6 Å, Crystal structure of Ssr1698 in complex with heme c
3O1Y 1.75 Å, Electron transfer complexes: Experimental mapping of the redox-dependent cytochrome c…
1WEJ 1.8 Å, IgG1 FAB fragment (of E8 antibody) complexed with horse cytochrome C at 1.8 a resolution
3WC8 1.8 Å, Dimeric horse cytochrome c obtained by refolding with desalting method
3WUI 1.8 Å, Dimeric horse cytochrome c formed by refolding from molten globule state
6K9I 1.8 Å, High-resolution three-dimensional structure of horse heart cytochrome C at room…
1HRC 1.9 Å, High-resolution three-dimensional structure of horse heart cytochrome C
3O20 1.9 Å, Electron transfer complexes:experimental mapping of the Redox-dependent Cytochrome C…
5IY5 2.0 Å, Electron transfer complex of cytochrome c and cytochrome c oxidase at 2.0 angstrom…
3NBT 2.1 Å, Crystal structure of trimeric cytochrome c from horse heart
4NFG 2.11 Å, K13R mutant of horse cytochrome c and yeast cytochrome c peroxidase complex

Browse structure collections

About this viewer

MolViewer shows 1CRC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.