High-resolution three-dimensional structure of horse heart cytochrome C at room temperature. Determined by X-ray diffraction at 1.8 Å resolution. Released 17 Jun 2020.
Explore 6K9I in 3D Show helices and sheets RCSB PDB PDBe
6K9I contains 8 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-13 | 11 | |
| α-helix | 24-26 | 3 | |
| β-strand | 39 | 1 | 1 |
| α-helix | 50-54 | 5 | |
| α-helix | 57 | 1 | |
| β-strand | 58 | 1 | 1 |
| α-helix | 59 | 1 | |
| α-helix | 61-69 | 9 | |
| α-helix | 71-74 | 4 | |
| α-helix | 88-101 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cytochrome c | A | protein | 105 | Equus caballus | P00004 (AlphaFold model) |
>6K9I_1 Cytochrome c (chains A) XGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFTYTDANKNKGITW KEETLMEYLENPKKYIPGTKMIFAGIKKKTEREDLIAYLKKATNE
| ID | Name | Formula | Copies |
|---|---|---|---|
| HEC | Heme C | C34 H36 Fe N4 O4 | 1 |
High-resolution three-dimensional structure of horse heart cytochrome C. Fujita, T., Yamamura, S., Endo, S. et al. To be published.
Other PDB entries of the same protein (UniProt P00004 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6K9I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.