0.98 A three-dimensional structure of horse heart cytochrome C at 110K. Determined by X-ray diffraction at 0.98 Å resolution. Released 17 Jun 2020.
Explore 6K9J in 3D Show helices and sheets RCSB PDB PDBe
6K9J contains 8 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-13 | 11 | |
| α-helix | 24-26 | 3 | |
| β-strand | 39 | 1 | 1 |
| α-helix | 50-54 | 5 | |
| α-helix | 57 | 1 | |
| β-strand | 58 | 1 | 1 |
| α-helix | 59 | 1 | |
| α-helix | 61-69 | 9 | |
| α-helix | 71-74 | 4 | |
| α-helix | 88-101 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cytochrome c | A | protein | 105 | Equus caballus | P00004 (AlphaFold model) |
>6K9J_1 Cytochrome c (chains A) XGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFTYTDANKNKGITW KEETLMEYLENPKKYIPGTKMIFAGIKKKTEREDLIAYLKKATNE
| ID | Name | Formula | Copies |
|---|---|---|---|
| HEC | Heme C | C34 H36 Fe N4 O4 | 1 |
0.98 A three-dimensional structure of horse heart cytochrome C at 110K. Sugawara, Y., Endo, S. To be published.
Other PDB entries of the same protein (UniProt P00004 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6K9J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.