1CWW: Caspase recruitment domain (CARD) from apaf-1

Solution structure of the caspase recruitment domain (CARD) from apaf-1. Determined by solution NMR. Released 21 Jan 2000.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 804
Mol. weight: 11.51 kDa
Released: 21 Jan 2000

Explore 1CWW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1CWW contains 8 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	-1	1	1
α-helix	1-2	2
α-helix	3-10	8
α-helix	16-19	4
α-helix	23-32	10
α-helix	37-45	9
α-helix	49-60	12
β-strand	64	1	1
α-helix	65-77	13
α-helix	81-88	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Apoptotic protease activating factor 1	A	protein	102	Homo sapiens	O14727 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1CWW_1 APOPTOTIC PROTEASE ACTIVATING FACTOR 1 (chains A)
GPLGSMDAKARNCLLQHREALEKDIKTSYIMDHMISDGFLTISEEEKVRNEPTQQQRAAM
LIKMILKKDNDSYVSFYNALLHEGYKDLAALLHDGIPVVSSS

Primary citation

Solution structure and mutagenesis of the caspase recruitment domain (CARD) from Apaf-1. Day, C.L., Dupont, C., Lackmann, M. et al. Cell Death Differ (1999) 6:1125-1132. DOI 10.1038/sj.cdd.4400584 · PubMed

Other PDB entries of the same protein (UniProt O14727 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1CY5 1.3 Å, Crystal structure of the apaf-1 card
2P1H 1.59 Å, Rapid Folding and Unfolding of Apaf-1 CARD
2YGS 1.6 Å, Card domain from apaf-1
4RHW 2.1 Å, Crystal structure of Apaf-1 CARD and caspase-9 CARD complex
1Z6T 2.21 Å, Structure of the apoptotic protease-activating factor 1 bound to ADP
3YGS 2.5 Å, Apaf-1 card in complex with prodomain of procaspase-9
8XQK 2.85 Å, The Crystal Structure of Apaf from Biortus.
5WVC 2.99 Å, Structure of the CARD-CARD disk
3JBT 3.8 Å, Atomic structure of the Apaf-1 apoptosome
5JUY 4.1 Å, Active human apoptosome with procaspase-9
5WVE 4.4 Å, Apaf-1-Caspase-9 holoenzyme
3J2T 9.5 Å, An improved model of the human apoptosome

Browse structure collections

About this viewer

MolViewer shows 1CWW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.