5LLK: Human alpha-dystroglycan

Crystal structure of human alpha-dystroglycan. Determined by X-ray diffraction at 1.8 Å resolution. Released 12 Jul 2017.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,839
Mol. weight: 28.68 kDa
Released: 12 Jul 2017

Explore 5LLK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5LLK contains 13 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	70-73	4	1
β-strand	78-81	4	2
α-helix	84-87	4
β-strand	93-98	6	1
α-helix	104-105	2
β-strand	108-111	4	2
β-strand	116-119	4	2
α-helix	123-125	3
β-strand	127-138	12	1
β-strand	144-157	14	1
α-helix	158	1
α-helix	159-161	3
α-helix	182-183	2
α-helix	186-187	2
β-strand	188-195	8	3
α-helix	199-201	3
α-helix	204-218	15
α-helix	222-224	3
β-strand	225-229	5	3
β-strand	242-245	4	3
β-strand	256-264	9	3
α-helix	272-273	2
α-helix	275-283	9
α-helix	285-290	6
β-strand	294-302	9	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Dystroglycan	A	protein	266	Homo sapiens	Q14118 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5LLK_1 Dystroglycan (chains A)
GSSVLSDLHEAVPTVVGIPDGTAVVGRSFRVTIPTDLIASSGDIIKVSAAGKEALPSWLH
WDSQSHTLEGLPLDTDKGVHYISVSATRLGANGSHIPQTSSVFSIEVYPEDHSELQSVHT
ASPDPGEVVSSACAADEPVTVLTVILDADLTKMTPKQRIDLLHRMRSFSEVELHNMKLVP
VVNNRLFDMSAFMAGPGNAKKVVENGALLSWKLGCSLNQNSVPDIHGVEAPAREGAMSAQ
LGYPVVGWHIANKKPPLPKRVRRQIH

Primary citation

Structural flexibility of human alpha-dystroglycan. Covaceuszach, S., Bozzi, M., Bigotti, M.G. et al. FEBS Open Bio (2017) 7:1064-1077. DOI 10.1002/2211-5463.12259 · PubMed

Other PDB entries of the same protein (UniProt Q14118 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5GGP 1.6 Å, Crystal structure of N-terminal domain of human protein O-mannose…
1EG4 2.0 Å, Structure of a dystrophin ww domain fragment in complex with a beta-dystroglycan peptide
7E9K 2.05 Å, Crystal Structure of POMGNT2 in complex with UDP and mono-mannosyl peptide (379Man long…
7E9L 2.1 Å, Crystal Structure of POMGNT2 in complex with UDP and mono-mannosyl peptide (379Man short…
6JJY 2.3 Å, Crystal Structure of KIBRA and beta-Dystroglycan
8UF4 2.43 Å, Crystal structure of wildtype dystroglycan proteolytic domain (juxtamembrane domain)
2MK7 Tetra-O-GalNAc glycosylated mucin sequence from alpha dystroglycan mucin domain

Browse structure collections

About this viewer

MolViewer shows 5LLK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.