8UF4: Wildtype dystroglycan proteolytic domain

Crystal structure of wildtype dystroglycan proteolytic domain (juxtamembrane domain). Determined by X-ray diffraction at 2.43 Å resolution. Released 11 Sept 2024.

Method: X-ray diffraction
Resolution: 2.43 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,700
Mol. weight: 58.02 kDa
Ligands: CA
Released: 11 Sept 2024

Explore 8UF4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8UF4 contains 23 α-helices and 36 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	493-497	5
β-strand	498-499	2	1
β-strand	505-509	5	2
β-strand	514-517	4	3
α-helix	518-519	2
β-strand	523-525	3	1
β-strand	529-530	2	1
α-helix	531-533	3
β-strand	535-539	5	2
β-strand	552-555	4	3
β-strand	560-563	4	3
α-helix	567-569	3
β-strand	571-580	10	2
β-strand	586-596	11	2
α-helix	597-598	2
β-strand	606-612	7	4
α-helix	617-620	4
α-helix	623-636	14
β-strand	645-651	7	4

Chains B and D: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	655-661	7	4
α-helix	671-681	11
β-strand	682	1	5
α-helix	687	1
β-strand	688	1	5
α-helix	689	1
α-helix	690-696	7
β-strand	702-709	8	4
α-helix	711-713	3
β-strand	717-719	3	4

Chain C: 6 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	499	1	6
β-strand	505-509	5	7
β-strand	514-517	4	8
α-helix	518-519	2
β-strand	523	1	6
β-strand	524	1	9
β-strand	530	1	9
β-strand	535-539	5	7
β-strand	545	1	7
α-helix	546-547	2
β-strand	552-555	4	8
β-strand	560-563	4	8
α-helix	567-569	3
β-strand	571-580	10	7
β-strand	586-596	11	7
α-helix	597-598	2
β-strand	606-612	7	10
α-helix	617-620	4
α-helix	623-636	14
β-strand	645-652	8	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
a-dystroglycan	A, C	protein	163	Homo sapiens	Q14118 (AlphaFold model)
Beta-dystroglycan	B, D	protein	95	Homo sapiens	Q14118 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>8UF4_1 a-dystroglycan (chains A, C)
GEPNQRPELKNHIDRVDAWVGTYFEVKIPSDTFYDHEDTTTDKLKLTLKLREQQLVGEKS
WVQFNSNSQLMYGLPDSSHVGKHEYFMHATDKGGLSAVDAFEIHVHRRPQGDRAPARFKA
KFVGDPALVLNDIHKKIALVKKLAFAFGDRNCSTITLQNITRG

Sequence of entity 2 (B, D), FASTA

>8UF4_2 Beta-dystroglycan (chains B, D)
SIVVEWTNNTLPLEPCPKEQIAGLSRRIAEDDGKPRPAFSNALEPDFKATSITVTGSGSC
RHLQFIPVVPPRRVPSEAPPTEVPDRDPEKSSEDD

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1

Water and common crystallization additives (CL) are not listed.

Primary citation

Molecular basis of proteolytic cleavage regulation by the extracellular matrix receptor dystroglycan. Anderson, M.J.M., Hayward, A.N., Smiley, A.T. et al. Structure (2024) 32:1984-1996.e5. DOI 10.1016/j.str.2024.08.019 · PubMed

Other PDB entries of the same protein (UniProt Q14118 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5GGP 1.6 Å, Crystal structure of N-terminal domain of human protein O-mannose…
5LLK 1.8 Å, Crystal structure of human alpha-dystroglycan
1EG4 2.0 Å, Structure of a dystrophin ww domain fragment in complex with a beta-dystroglycan peptide
7E9K 2.05 Å, Crystal Structure of POMGNT2 in complex with UDP and mono-mannosyl peptide (379Man long…
7E9L 2.1 Å, Crystal Structure of POMGNT2 in complex with UDP and mono-mannosyl peptide (379Man short…
6JJY 2.3 Å, Crystal Structure of KIBRA and beta-Dystroglycan
2MK7 Tetra-O-GalNAc glycosylated mucin sequence from alpha dystroglycan mucin domain

Browse structure collections

About this viewer

MolViewer shows 8UF4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.