2NC9: Apo solution structure of Hop TPR2A

Apo solution structure of Hop TPR2A. Determined by solution NMR. Released 29 Mar 2017.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,094
Mol. weight: 15.57 kDa
Released: 29 Mar 2017

Explore 2NC9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2NC9 contains 7 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	10-25	16
α-helix	30-43	14
α-helix	48-61	14
α-helix	64-78	15
α-helix	85-101	17
α-helix	105-118	14
α-helix	122-138	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Stress-induced-phosphoprotein 1	A	protein	131	Homo sapiens	P31948 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2NC9_1 Stress-induced-phosphoprotein 1 (chains A)
ENKKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCR
ELCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKC
QQAEKILKEQE

Primary citation

Solution structure of the Hop TPR2A domain and investigation of target druggability by NMR, biochemical and in silico approaches. Darby, J.F., Vidler, L.R., Simpson, P.J. et al. Sci Rep (2020) 10:16000-16000. DOI 10.1038/s41598-020-71969-w · PubMed

Other PDB entries of the same protein (UniProt P31948 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1ELW 1.6 Å, Crystal structure of the TPR1 domain of HOP in complex with a HSC70 peptide
1ELR 1.9 Å, Crystal structure of the TPR2A domain of HOP in complex with the HSP90 peptide MEEVD
3ESK 2.05 Å, Structure of HOP TPR2A domain in complex with the non-cognate Hsc70 peptide ligand
9QQU 2.13 Å, Crystal structure of an engineered TPR domain in complex with the HSP90 peptide MEEVD
3FWV 2.2 Å, Crystal Structure of a Redesigned TPR Protein, T-MOD(VMY), in Complex with MEEVF Peptide
7KW7 3.57 Å, Atomic cryoEM structure of Hsp90-Hsp70-Hop-GR
2LNI Solution NMR Structure of Stress-induced-phosphoprotein 1 STI1 from Homo sapiens,…

Browse structure collections

About this viewer

MolViewer shows 2NC9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.