2LNI: Stress-induced-phosphoprotein 1

Solution NMR Structure of Stress-induced-phosphoprotein 1 STI1 from Homo sapiens, Northeast Structural Genomics Consortium Target HR4403E. Determined by solution NMR. Released 14 Mar 2012.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,069
Mol. weight: 15.37 kDa
Released: 14 Mar 2012

Explore 2LNI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LNI contains 8 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	15-28	14
α-helix	33-43	11
α-helix	50-60	11
α-helix	66-79	14
α-helix	84-96	13
α-helix	100-113	14
α-helix	115-117	3
α-helix	119-131	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Stress-induced-phosphoprotein 1	A	protein	133	Homo sapiens	P31948 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2LNI_1 Stress-induced-phosphoprotein 1 (chains A)
MGHHHHHHSHMNPDLALMVKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACY
TKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEA
ADGYQRCMMAQYN

Primary citation

Northeast Structural Genomics Consortium Target HR4403E. Tang, Y., Liu, G., Hamilton, K. et al. To be published.

Other PDB entries of the same protein (UniProt P31948 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1ELW 1.6 Å, Crystal structure of the TPR1 domain of HOP in complex with a HSC70 peptide
1ELR 1.9 Å, Crystal structure of the TPR2A domain of HOP in complex with the HSP90 peptide MEEVD
3ESK 2.05 Å, Structure of HOP TPR2A domain in complex with the non-cognate Hsc70 peptide ligand
9QQU 2.13 Å, Crystal structure of an engineered TPR domain in complex with the HSP90 peptide MEEVD
3FWV 2.2 Å, Crystal Structure of a Redesigned TPR Protein, T-MOD(VMY), in Complex with MEEVF Peptide
7KW7 3.57 Å, Atomic cryoEM structure of Hsp90-Hsp70-Hop-GR
2NC9 Apo solution structure of Hop TPR2A

Browse structure collections

About this viewer

MolViewer shows 2LNI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.