1ELW: TPR1 domain of HOP

Name: PDB 1ELW: Crystal structure of the TPR1 domain of HOP in complex with a HSC70 peptide
Published: 2000-04-26
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: chaperone

Crystal structure of the TPR1 domain of HOP in complex with a HSC70 peptide. Determined by X-ray diffraction at 1.6 Å resolution. Released 26 Apr 2000.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,240
Mol. weight: 29.34 kDa
Ligands: NI
Released: 26 Apr 2000

Explore 1ELW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1ELW contains 16 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	3-16	14
α-helix	20-33	14
α-helix	38-51	14
α-helix	54-67	14
α-helix	72-84	13
α-helix	88-99	12
α-helix	106-117	12

Chain B: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	2-16	15
α-helix	20-33	14
α-helix	38-51	14
α-helix	54-67	14
α-helix	72-84	13
α-helix	88-101	14
α-helix	106-114	9

Chains C and D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	9-11	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
TPR1-domain of hop	A, B	protein	118	Homo sapiens	P31948 (AlphaFold model)
HSC70-peptide	C, D	protein	8

Sequence of entity 1 (A, B), FASTA

>1ELW_1 TPR1-DOMAIN OF HOP (chains A, B)
MEQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYED
GCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEAR

Sequence of entity 2 (C, D), FASTA

>1ELW_2 HSC70-PEPTIDE (chains C, D)
GPTIEEVD

Ligands and cofactors

ID	Name	Formula	Copies
NI	Nickel (II) ion	Ni	4

Water and common crystallization additives (TRS) are not listed.

Primary citation

Structure of TPR domain-peptide complexes: critical elements in the assembly of the Hsp70-Hsp90 multichaperone machine. Scheufler, C., Brinker, A., Bourenkov, G. et al. Cell (2000) 101:199-210. DOI 10.1016/S0092-8674(00)80830-2 · PubMed

Other PDB entries of the same protein (UniProt P31948 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1ELR 1.9 Å, Crystal structure of the TPR2A domain of HOP in complex with the HSP90 peptide MEEVD
3ESK 2.05 Å, Structure of HOP TPR2A domain in complex with the non-cognate Hsc70 peptide ligand
9QQU 2.13 Å, Crystal structure of an engineered TPR domain in complex with the HSP90 peptide MEEVD
3FWV 2.2 Å, Crystal Structure of a Redesigned TPR Protein, T-MOD(VMY), in Complex with MEEVF Peptide
7KW7 3.57 Å, Atomic cryoEM structure of Hsp90-Hsp70-Hop-GR
2LNI Solution NMR Structure of Stress-induced-phosphoprotein 1 STI1 from Homo sapiens,…
2NC9 Apo solution structure of Hop TPR2A

Browse structure collections

About this viewer

MolViewer shows 1ELW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.