Core structure of the outer membrane lipoprotein from escherichia coli at 1.9 Å resolution. Determined by X-ray diffraction at 1.9 Å resolution. Released 28 Jun 2000.
Explore 1EQ7 in 3D Show helices and sheets RCSB PDB PDBe
1EQ7 contains 1 α-helix and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-52 | 49 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Outer membrane lipoprotein | A | protein | 56 | Escherichia coli | P69776 (AlphaFold model) |
>1EQ7_1 OUTER MEMBRANE LIPOPROTEIN (chains A) SSNAKIDQLSSDVQTLNAKVDQLSNDVNAMRSDVQAAKDDAARANQRLDNMATKYR
Core structure of the outer membrane lipoprotein from Escherichia coli at 1.9 A resolution. Shu, W., Liu, J., Ji, H. et al. J Mol Biol (2000) 299:1101-1112. DOI 10.1006/jmbi.2000.3776 · PubMed
Other PDB entries of the same protein (UniProt P69776 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1EQ7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.