1KFN: Major outer membrane lipoprotein

Core side-chain packing and backbone conformation in Lpp-56 coiled-coil mutants. Determined by X-ray diffraction at 1.65 Å resolution. Released 28 Jun 2002.

Method: X-ray diffraction
Resolution: 1.65 Å
Organism: Escherichia coli
Chains: 1
Atoms: 427
Mol. weight: 6 kDa
Released: 28 Jun 2002

Explore 1KFN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1KFN contains 1 α-helix and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	2-49	48

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Major outer membrane lipoprotein	A	protein	56	Escherichia coli	P69776 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1KFN_1 MAJOR OUTER MEMBRANE LIPOPROTEIN (chains A)
SSNAKIDQLSSDVQTLNAKVDQASNDANAARSDAQAAKDDAARANQRLDNMATKYR

Primary citation

Core side-chain packing and backbone conformation in Lpp-56 coiled-coil mutants. Liu, J., Cao, W., Lu, M. J Mol Biol (2002) 318:877-888. DOI 10.1016/S0022-2836(02)00138-9 · PubMed

Other PDB entries of the same protein (UniProt P69776 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1JCD 1.3 Å, Crystal Structure of a Novel Alanine-Zipper Trimer at 1.3 A Resolution,…
2GUV 1.4 Å, Conformational Transition between Four- and Five-stranded Phenylalanine Zippers…
1T8Z 1.45 Å, Atomic Structure of A Novel Tryptophan-Zipper Pentamer
1JCC 1.7 Å, Crystal Structure of a Novel Alanine-Zipper Trimer at 1.7 A Resolution,…
2GUS 1.75 Å, Conformational Transition between Four- and Five-stranded Phenylalanine Zippers…
1EQ7 1.9 Å, Core structure of the outer membrane lipoprotein from escherichia coli at 1.9 Å resolution
1KFM 2.0 Å, Core side-chain packing and backbone conformation in Lpp-56 coiled-coil mutants
9RLC 2.8 Å, LolCDE complex with Lpp lipoprotein
9RLD 3.0 Å, LolCDE complex with Lpp lipoprotein
7ARJ 3.2 Å, LolCDE in complex with lipoprotein and AMPPNP complex undimerized form
7ARL 3.2 Å, LolCDE in complex with lipoprotein and ADP
7ARH 3.3 Å, LolCDE in complex with lipoprotein

Browse structure collections

About this viewer

MolViewer shows 1KFN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.